SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K8FF60 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K8FF60
Domain Number 1 Region: 21-105
Classification Level Classification E-value
Superfamily Chaperone J-domain 2.88e-23
Family Chaperone J-domain 0.00067
Further Details:      
 
Domain Number 2 Region: 330-420
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000014
Family PDI-like 0.041
Further Details:      
 
Weak hits

Sequence:  K8FF60
Domain Number - Region: 189-297
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000561
Family Calsequestrin 0.089
Further Details:      
 
Domain Number - Region: 686-745
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0317
Family Thioltransferase 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K8FF60
Sequence length 806
Comment (tr|K8FF60|K8FF60_9CHLO) Chaperone protein DnaJ {ECO:0000313|EMBL:CCO66846.1} KW=Complete proteome; Reference proteome OX=41875 OS=Bathycoccus prasinos. GN=Bathy09g01840 OC=Mamiellales; Bathycoccaceae; Bathycoccus.
Sequence
MMMMRAVASSRFFFLFFFLSFFSYFISGEKDLNPYAILGVDKTADASAIKRSYRKLSLRF
HPDKQHTINDDEEKEKIERKFMSIQMAYKTLIDPEKRRNYDVTGYANLKDLERDEKRKEK
EEGEKKGGYQRFTKKKGSSSSSSSSRMKRGGWDSEEQTIDSIDSETFDFTSLSAFESIVF
NRRRNSKDNNAGAVGGNSWLIEVYDDASEPSQRASSSWEQASRALDGFAKFGRVNQKLYR
RLAVKVAPKYFMSNEPIAFTKLPAVVGFAQGCNNFWCAQRYRGEMKADDLGSFVMDKLLR
LKEVPSVASEELEQNFAPVTIRGNIKDENKKTPKNDKVKFIIFSPRATTPSPTLRKLATE
YSDDVHVVRIHHTERDQGKWKQIYGVESAPAVVVLKSESNEVIVKHGVSGKESLKRLFTE
HHFQLIPEIMSRSMDDIRCKSGGLTRLCVLLLGDERETTESLKHTLSSIKKDLQKERDES
NEEGLNAMKVSLSTALENDEIVFARIDCVKQKKACQAYSFKRGSSNAELRALRFISDKPG
KMSNVLFKGNAVDIEEVYEWIGELFNADETSRSLQDEVSKALLIQERLGLKTQLEQFRMD
ILQTVARVLEESVIMMVEIGPFPIIFMFVLQISLFRFLRNRKFARSAQNVPSADTVDTST
SNALDANDIVMNLSEFSERTTALTKSVYVVLQFINSRDKGPVVEQIQGLQALAKKFKSER
LLRFAYVDLDQNVSWKSFVNDVGENSVCVWHPSKLKYEKLGISCVEDGVCTKLDAVLDGS
ANWEKEIKDNAWFHSSSSVKNRDMKK
Download sequence
Identical sequences K8FF60
XP_007511286.1.44737 Bathy09g01840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]