SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9IV43 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9IV43
Domain Number 1 Region: 57-837
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.52e-293
Family Motor proteins 1.74e-16
Further Details:      
 
Domain Number 2 Region: 838-963
Classification Level Classification E-value
Superfamily Myosin rod fragments 4.53e-22
Family Myosin rod fragments 0.00034
Further Details:      
 
Domain Number 3 Region: 958-1074
Classification Level Classification E-value
Superfamily Myosin rod fragments 9.59e-21
Family Myosin rod fragments 0.001
Further Details:      
 
Domain Number 4 Region: 1244-1351
Classification Level Classification E-value
Superfamily Myosin rod fragments 1.26e-17
Family Myosin rod fragments 0.0025
Further Details:      
 
Domain Number 5 Region: 1061-1152
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000000017
Family Myosin rod fragments 0.0037
Further Details:      
 
Domain Number 6 Region: 1516-1629
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000000785
Family Myosin rod fragments 0.0011
Further Details:      
 
Domain Number 7 Region: 1351-1452
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000000288
Family Myosin rod fragments 0.0094
Further Details:      
 
Domain Number 8 Region: 1761-1862
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.000033
Family Regulator of G-protein signaling, RGS 0.0081
Further Details:      
 
Weak hits

Sequence:  K9IV43
Domain Number - Region: 29-62
Classification Level Classification E-value
Superfamily Myosin S1 fragment, N-terminal domain 0.0392
Family Myosin S1 fragment, N-terminal domain 0.0016
Further Details:      
 
Domain Number - Region: 1628-1745
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0654
Family Myosin rod fragments 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K9IV43
Sequence length 1962
Comment (tr|K9IV43|K9IV43_DESRO) Putative myosin class v heavy chain {ECO:0000313|EMBL:JAA53320.1} OX=9430 OS=Desmodus rotundus (Vampire bat). GN= OC=Phyllostomidae; Desmodontinae; Desmodus.
Sequence
VTMAQQAADKYLYVDKNFINNPLAQADWAAKKLVWVPSDKSGFEPASLKEEVGEEAIVEL
VENGKKVKVNKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLKERYYSGLIYTYSGLFC
VVINPYKNLPIYSEEIVDMYKGKKRHEMPPHIYAITDTAYRSMMQDREDQSILCTGESGA
GKTENTKKVIQYLAHVASSHKSKKDQGELERQLLQANPILEAFGNAKTVKNDNSSRFGKF
IRINFDVNGYIVGANIETYLLEKSRAIRQAKEERTFHIFYYLLSGAGEHLKTDLLLEPYN
KYRFLSNGHVTIPGQQDKDMFQETMEAMRIMGIPEEEQIGLLRVISGVLQLGNIVFKKER
NTDQASMPDNTAAQKVSHLLGINVTDFTRGILTPRIKVGRDYVQKAQTKEQADFAIEALA
KATYERMFRWLVLRINKALDKTKRQGASFIGILDIAGFEIFDLNSFEQLCINYTNEKLQQ
LFNHTMFVLEQEEYQREGIEWNFIDFGLDLQPCIDLIEKPAGPPGILALLDEECWFPKAT
DKSFVEKVVQEQGTHPKFQKPKQLKDKADFCIMHYAGKVDYKADEWLMKNMDPLNDNIAT
LLHQSSDKFVSELWKDVDRIIGLDQVAGMSETALPGAFKTRKGMFRTVGQLYKEQLAKLM
ATLRNTNPNFVRCIIPNHEKKAGKLDPHLVLDQLRCNGVLEGIRICRQGFPNRVVFQEFR
QRYEILTPNSIPKGFMDGKQACVLMIKALELDSNLYRIGQSKVFFRAGVLAHLEEERDLK
ITDVIIGFQACCRGYLARKAFAKRQQQLTAMKVLQRNCAAYLKLRNWQWWRLFTKVKPLL
QVSRQEEEMMAKEEELVKVREKQVAAENRLVEMETLQSQLMAEKLQLQEQLQAETELCAE
AEELRARLTAKKQELEEICHDLEARVEEEEERCQHLQTEKKKMQQNIQELEEQLEEEESA
RQKLQLEKVTTEAKLKKLEEDQIILEDQNCKLAKEKKLLEDRIAEFTTNLTEEEEKSKSL
AKLKNKHEAMITDLEERLRREEKQRQELEKTRRKLEGDSTDLNDQIAELQAQIAELKMQL
AKKEEELQAALARVEEEATQKNMALKKIRELESQISELQEDLESERASRNKAEKQKRDLG
EELEALKTELEDTLDSTAAQQELRSKREQEVNILKKTLEEEAKTHEAQIQEMRQKHSQAV
EELAEQLEQTKRVKANLEKAKQTLENERGELANEVKVLLQGKGDSEHKRKKVEAQLQELQ
VKFNEGERVRTELADKVTKLQVELDNVTGLLTQSDSKSSKLTKDFSTLESQLQDTQELLQ
EENRQKLGLSTKLKQVEDEKNSLKEQLEEEEEAKHNLEKQIATLHAQVTDMKKKMEDGVG
CLETVEEAKRKLQKDLEGLSQRYEEKVAAYDKLEKTKTRLQQELDDLLVDLDHQRQSVSN
LEKKQKKFDQLLAEEKTISAKYAEERDRAEAEAREKETKALSLARALEEAVEQKAELERL
NKQFRTEMEDLMSSKDDVGKSVHELEKSKRALEQQVEEMKTQLEELEDELQATEDAKLRL
EVNLQAMKAQFERDLQGRDEQSEEKKKQLVRQVREMEAELEDERKQRSMAMAARKKLEMD
LKDLEAHIDSANKNRDEAIKQLRKLQAQMKDYMRELDDTRASREEILAQAKENEKKLKSM
EAEMIQLQEELAAAERAKRQAQQERDELADEIANSSGKGALALEEKRRLEARIAQLEEEL
EEEQGNTELVNDRLKKANLQIDQINTDLNLERSHAQKNENARQQLERQNKELKVKLQEME
GTVKSKYKASITALEAKIAQLEEQLDNETKERQAACKQVRRAEKKLKDVLLQVDDERRNA
EQFKDQADKASTRLKQLKRQLEEAEEEAQRANASRRKLQRELEDATETADAMNREVSSLK
NKLRRGDLPFVVPRRMARKGAGECSDEEVDGKADGAEAKAAE
Download sequence
Identical sequences K9IV43

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]