SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9K3Z4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9K3Z4
Domain Number 1 Region: 99-481
Classification Level Classification E-value
Superfamily Duffy binding domain-like 3.53e-79
Family Duffy binding domain 0.00018
Further Details:      
 
Domain Number 2 Region: 1308-1652
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.31e-77
Family Duffy binding domain 0.00019
Further Details:      
 
Domain Number 3 Region: 2356-2372,2421-2481,2514-2609,2652-2835
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.97e-77
Family Duffy binding domain 0.00078
Further Details:      
 
Domain Number 4 Region: 1801-2132
Classification Level Classification E-value
Superfamily Duffy binding domain-like 8.24e-77
Family Duffy binding domain 0.00013
Further Details:      
 
Domain Number 5 Region: 794-1143
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.19e-74
Family Duffy binding domain 0.00013
Further Details:      
 
Domain Number 6 Region: 472-678
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.31e-31
Family Duffy binding domain 0.0054
Further Details:      
 
Domain Number 7 Region: 2862-2975
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.29e-17
Family Duffy binding domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K9K3Z4
Sequence length 2980
Comment (tr|K9K3Z4|K9K3Z4_PLAFA) Erythrocyte membrane protein 1 {ECO:0000313|EMBL:AEI26313.1} OX=5833 OS=Plasmodium falciparum (malaria parasite P. falciparum). GN= OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MGNASSSEGEAKTPSLTESHNSARNILEGYAESIKEQASKDAKIHGHHLKGDLAKAVFRH
PFSAYRPNYGNPCELDYRFHTNVWHRNAEDRNPCLFSRAKRFSNEGEAECNGGIITGNKG
ECGACAPYRRRHICDYNLHHINENNIRNTHDLLGNLLVMARSEGESIVKSHEYTGYGIYK
SGICTSLARSFADIGDIIRGKDLYRRDSRTDKLEENLRKIFANIYKELKNGKKWAEAKEY
YQDDGTGNYYKLREAWWALNRKDVWKALTCSAPRDAQYFIKSSVRDQTFSNDYCGHGEHE
VLTNLDYVPQFLRWFEEWAEEFCRIKKIKLGKVKEACRDDSKKLYCSHNGYDCTKTIRNK
DILSDNPKCTGCSVKCKVYELWLRNQRNEFEKQKKKYYKEIQTYTSKDAKTDSNINNEYY
KEFYDKLKNEGYETLNKFIKLLNEGRYCKEKISGERNIDFTMTGDKDAFYRSDYCQICPE
CGVQCSGTTCTPKKVIHPNCKDKETYEPGDAKTTDITVLYSGDEEGDIAQKLQDFCNDKN
KENDENYEKWQCYYKSSEINKCQMTPSSHKVPKHGYIMSFYAFFDLWVKNLLIDSINWKN
DLTNCINNTNVTDCKNDCNTNCKCFENWAKTKENEWKKVKTIYKNENGNTNNYYKKLNNH
FQGYFFHVMKELNKEEKWYKLMEDLKEKIDSSNLKNGTKDSEGAIKVLFDHLKDIAERCI
DNNSKDSCPPSVDTKTNPCAKPPGSKPTKSVKQLAEHMQQKAQKLLGTRGGESKLKGDAT
RGTYNLGGQGNTLNGDICKITKNHTNDSRPNGEPCTGKDKVKNGFRLKIGTPWTNIVQKK
KKKSYKDFYLPPRRQHMCTSNLENLSTSSKGLSNGSFASHSLLGDVLLAAKFEAQKIILV
YKNKNNINIRKRITDPNDQATVCRAIRYSFADLGDIIRGKDMWNINSDAKDLQDRLEKIF
KTINEKLPNEIQKRYTNRENKHLDLRSDWWEANRHQVWRAMKCATKGISNNNCNGIPIED
YIPQRLRWMTEWAEWYCKKQSQEYEKLEEKCGMCTGKGQGDGKDCTQKDKECSPCKKACD
AYKKEIEKWEKQWKTVSAIYQILYAKARIVASNGGPGYYNTEVQKKDRSVYDFLYELHLQ
NGGKKGPPPATHPYKSVNTRDKRDATDDTTPTVDTTPTVYSTAAGYIHQELPIVGCKGQE
VFCDNNGNKEKYAFKNPPNVYDEACKCMTREAPPPPTTPSTPNPCVNTTGAVSVTKSVMQ
LASEMQKKANETMLKNSSNGNGKDESALKGKAEEGDYSCGGTGNELQGNNICKISTRHSN
DKRGSSKDPCEGKDGQKKMFELKDGWNSGKKVKTPNDLFLPPRREHFCTSNLENLNLNSK
GLSNGSFASHSLLGDVLLAAKEVARFIKERYSEKIKENGFNDKETICRAIKYSFADIGDI
IKGTDLWDKNDGEITTQNKLVQVFEKIKEELGDKYIGDKAKSPYKQLRSDWWEANREEVW
KAMKCPAKNGTFPCSADKEPTPFDDYIPQRLRWMTEWAEWFCKMQKEEYDKLVTGCGGCK
EKGDKECKKEIAECKQCEPQCKQYTEFIKKWKTQWETISTKYKTLYQQAKDSVNNDTTSS
TTEEKDRDVVEFLKKLQKQNSGNNIYSTAAGYVHQELPNMDCQKQTHFCNKNSDGSDKEY
AFKERPTEFDDALRCDQRDKPPPAPKKVEKAKKEKDDEEDEEPRNQQNPCVTGGDVAGVD
KITSVTDVAEGMQGDAHTKMLERSRKSDGESTKAGKGSKSNENGESVLKGDIKNAKFKNN
PNPSELKNVCDITNDHSNTLRHLSLNPCNGKNTERFYTGKDWTDLDKEKKSSYTDVYLPQ
RREHMCTSNLEYLEINRSPLNGSDGKLVNNSFLGDVLLAAKFEAEKIKELYKPTSDHESV
CRAVSRSFADIGDIIRGRDMWDKDKGSTDMENRLVPIFKNIKENLDVIKGYDKYKDTKKY
LNLRADWWEANRDQIWEAMQCPTKPAVINTKCGTDTPLMDYIPQRLRWMTEWAEWYCKIQ
KKEYEELERKCGECKGGKCMNGEDMCDKCKAACTTYGLKIKKWAEQWIKIKDKYDKLYEK
AKQYSADTSPSEPKDEEDVVNFLKELRKKIVIIPYILVLQDMYIKKLNTLIAINKLSFVN
KKMVINQLMVKKKWTTRNMLLKNLHMSTKLRVIVKQTRNRKFLQQKSPEVPKEVVPEKKI
SVPPPKKPEVPPLLPSRPPRDGRHDQRGRNEPGEGQRPLPGPRSPPAPAGGSLARSLPPR
DTQEQEEDEDEDEEEAEKTEQVDTAVELPGPSATPVQELPGPTATTTQDGVKPACKIVDD
LFTSGDTALKEACSLKYGPGGKEKFPNWKCVSSGNDKVTGGVPTTKSSGSGSTATSGESG
NRSKRHTESSGESAKASGTNQGSICVPPRRRKLYVGKLHDWASRGGVETTEAKSQSESDK
LREAFIQSAAIETFFAWHKYKAENTKTQGSVVAPPLLNGSRLSGEDPEKQLQQGTIPEEF
KRLMFYTLGDYRDICVGNTNIVEAAISPSEKQKMEAIQKKIKENIEKLLPKNGGTSPGPQ
NSDKTRQTLWGDFAQDIWHGMICALTYKENGTAADGKKIEKVNDANGGEDLFDTLKNGND
YENVKLDDTSDTQTKTNNDQPPTLKNFVVRPTFFRWLEEWGEEFCRKQRHKLKNLEKQCR
GVNSSGNEKYCSGDGYDCEQTYFEHDDMFKGINCPDCVKECKKYKKWIEKKLEEFYKQKN
IYENEISKLNINYSNNVHDPKVYENLKKHSSVDKFLESLNHCKDGKSNSDQNKKIDFNKP
ENTFNPSTYCKACPLNGVNCGVKGGCEEKKEKLQTKKEGVLTNIPIVINDGATKDSYGEL
NGKCKQYGLYNDLRKQEWKCQHINNIYKCELQNYGNSQYFEKKIPFKILFERWIRDFVEN
YNKSKERITRCTNDVNSCKEGCKGNCDCVEEWLKKNLQNG
Download sequence
Identical sequences K9K3Z4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]