SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9PF34 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9PF34
Domain Number 1 Region: 4-295
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.32e-77
Family AstE/AspA-like 0.00000241
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K9PF34
Sequence length 302
Comment (tr|K9PF34|K9PF34_9CYAN) Probable aspartoacylase {ECO:0000256|HAMAP-Rule:MF_00704} KW=Complete proteome; Reference proteome OX=99598 OS=Calothrix sp. PCC 7507. GN=Cal7507_0678 OC=Bacteria; Cyanobacteria; Nostocales; Rivulariaceae; Calothrix.
Sequence
MNQISRVAIVGGTHGNEFTGAYLIQKFTQFPHLITKSSFVTITLLANPRAFQVARRYLDK
DLNRCFLQQDLQNRYLGSYEEMRAKSIYKILGSKGSSPADFILDLHSTTANMGLTIILVN
SHPFNLKLAAYLSQINPLVKVYRCSFPSVADNPFLNSLCELGFAIEVGPIAQGILRASLF
QQTEELIHTILEYLEKFNLGEIELTNIPLTIYQHLEVVDYPKNEDGAITAMIHPELQDRD
YQALNPGDPMFLTLDGQTIAYESKSTVWPIFINEAAYYEKGIAMCLTKQQQISIKDMNQQ
FN
Download sequence
Identical sequences K9PF34
WP_015126992.1.42896 gi|427716007|ref|YP_007064001.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]