SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9PHT7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9PHT7
Domain Number 1 Region: 1-82
Classification Level Classification E-value
Superfamily Ribosomal protein S16 9.16e-27
Family Ribosomal protein S16 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K9PHT7
Sequence length 88
Comment (tr|K9PHT7|K9PHT7_9CYAN) 30S ribosomal protein S16 {ECO:0000256|HAMAP-Rule:MF_00385} KW=Complete proteome; Reference proteome OX=99598 OS=Calothrix sp. PCC 7507. GN=Cal7507_1639 OC=Bacteria; Cyanobacteria; Nostocales; Rivulariaceae; Calothrix.
Sequence
MIKLRLKRYGKKREASYRIIAINSLSRRDGRPLEELGFYNPRTDEVRLDVPGIVKRLQQG
AQPTDTVRRILVKANVFEQVSATATAAS
Download sequence
Identical sequences K9PHT7
WP_015127915.1.42896 gi|427716937|ref|YP_007064931.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]