SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K9PIU1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9PIU1
Domain Number 1 Region: 39-222
Classification Level Classification E-value
Superfamily GAF domain-like 0.00000000000126
Family GAF domain 0.01
Further Details:      
 
Domain Number 2 Region: 238-462
Classification Level Classification E-value
Superfamily PP2C-like 0.00000034
Family PP2C-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K9PIU1
Sequence length 463
Comment (tr|K9PIU1|K9PIU1_9CYAN) Protein serine/threonine phosphatase with GAF(S) sensor(S) {ECO:0000313|EMBL:AFY32836.1} KW=Complete proteome; Reference proteome OX=99598 OS=Calothrix sp. PCC 7507. GN=Cal7507_2405 OC=Bacteria; Cyanobacteria; Nostocales; Rivulariaceae; Calothrix.
Sequence
MPVSQLPSQPTDSNSSAATDVTPVVALKELVARLHREQNKIQDLLSSLGFALRSFNNLNQ
FLELIPLMATRVTDADGSALFLYKPNGQVRLEQLHWQDSLQRKNIRKALETATSQITLVP
NAAPLATTTGMLDDQMHRYLGPDVQIFGTAILVKHTERGWLYVLSRDPEYSWTETRQKLV
RLVADQTAVAIENDELAVELRKKERLDQELEIGAEIQRRLLPRQCPTIPGAVLAARCKPA
NRVGGDYYDFIPTNHNQIQPQTKSLLEPGPLGLVIGDVMGKGVPAGLIMTMMRGMLRGEV
LHGNSPSGILQNLNRVMYADLENSHRFVTLFYSEYDPHTRILSYSNAAHNPPLWWHAATK
TVTRLDTLGMLIGLDANSQYEDAQVKLESGDTIIYYTDGLTDAAAAGGDRFDEENFVTSF
NTACKYCDGPEEIVDYLFDQVEQFIGADKQNTDDMTLVVLQIQ
Download sequence
Identical sequences K9PIU1
gi|427717676|ref|YP_007065670.1| WP_015128649.1.42896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]