SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9PIU7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9PIU7
Domain Number 1 Region: 1-255
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 4.08e-81
Family Histidine biosynthesis enzymes 0.000000118
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K9PIU7
Sequence length 257
Comment (tr|K9PIU7|K9PIU7_9CYAN) ImGP synthase subunit HisF {ECO:0000256|HAMAP-Rule:MF_01013} KW=Complete proteome; Reference proteome OX=99598 OS=Calothrix sp. PCC 7507. GN=Cal7507_2662 OC=Bacteria; Cyanobacteria; Nostocales; Rivulariaceae; Calothrix.
Sequence
MLSKRILPCLDVKAGRVVKGVNFVNLQDAGDPVELAKVYNEAGADELVFLDITATHEDRD
TIIDVVYRTAEQVFIPLTVGGGIQSLENVKGLLRAGADKVSINSAAVREPDFINRASDRF
GNQCIVVAIDARRRIDPNNPGWDVYVRGGRENTGKDALLWAKEVEKRGAGELLVTSMDAD
GTQAGYDLNLTKSIADAVQIPVIASGGAGTCEHIHAALTEGKAEAALLASQLHYGQLSVA
QIKNYLRDRSIPVRMFP
Download sequence
Identical sequences K9PIU7
gi|427717923|ref|YP_007065917.1| WP_015128895.1.42896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]