SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9PJE0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9PJE0
Domain Number 1 Region: 5-333
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.2e-85
Family TK-like PP module 0.0000596
Further Details:      
 
Domain Number 2 Region: 302-476
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.27e-49
Family TK-like Pyr module 0.0021
Further Details:      
 
Domain Number 3 Region: 482-620
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 8.64e-26
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K9PJE0
Sequence length 631
Comment (tr|K9PJE0|K9PJE0_9CYAN) Transketolase {ECO:0000313|EMBL:AFY32884.1} KW=Complete proteome; Reference proteome OX=99598 OS=Calothrix sp. PCC 7507. GN=Cal7507_2455 OC=Bacteria; Cyanobacteria; Nostocales; Rivulariaceae; Calothrix.
Sequence
MTTQQQLQQWYELAQQLRVDSIRATTVAGSGHPTSSMSPADLMAVLLSGFLRYDFNDPDN
PNNDRFILSKGHAAPLLYAMYKAAGVISDEDLLSLRKFGSPLEGHPTPVLPWVDVATGSL
GQGLPIGVGLALAGKYLDQLPYHVWVLLGDSETAEGSVWEAFDHAAHYGLDNLIAIIDVN
RLGQRGQTELGWNTQAYAKRARAFGWEAMEIDGHNLIEIDQAYSAALAVTDRPTVIIAQT
KKGKGVDALEDLGGWHGKALKPDDEKQAIAELGGERYITISVQKPEAQEQPAVTGNTHLL
QLPTYNKGAHVATRRAYGDALKALGAAQPDVVVLDAEVSNSTYAEDFAEAYPERYFEMFI
AEQQMVAAAIGLQVRKYKPFASTFAAFLTRAYDFVRMAAVSRANIKLVGSHAGVSIGQDG
PSQMGLEDLAAFQAVCGSTVLYPSDANQTAKLVEQMSDRSGVVYLRTTRESTEVLYGAEE
QFPIGGSKIVRISDRDQATVIAAGITLHEALKAYNRLKNEGIAVRVIDTYSVKPIDVHTL
HQAARDTKGNLVVVEDHWMEGGLGAAVLDAFAGHGDRPSYNGPQLQLIKLAVVDMPGSGT
PDELLHAAKIDAEAIVEAVKFQVRQPIGVSN
Download sequence
Identical sequences K9PJE0
WP_015128697.1.42896 gi|427717724|ref|YP_007065718.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]