SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9PKN8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9PKN8
Domain Number 1 Region: 38-573
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 1.38e-136
Family Arylsulfatase 0.000000869
Further Details:      
 
Domain Number 2 Region: 617-729
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000051
Family Laminin G-like module 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K9PKN8
Sequence length 784
Comment (tr|K9PKN8|K9PKN8_9CYAN) Sulfatase {ECO:0000313|EMBL:AFY33723.1} KW=Complete proteome; Reference proteome OX=99598 OS=Calothrix sp. PCC 7507. GN=Cal7507_3318 OC=Bacteria; Cyanobacteria; Nostocales; Rivulariaceae; Calothrix.
Sequence
MSLREYKPGNTFPGVIGRTVDKSSPAWPEPLRAKEGTPNVLFIVFDDTGFGQFGCYGSPI
KTPNLDALAANGLRYNNLHTTALCSPTRSCLLTGRNHHSNAMSCITEGSTGYPGGNGNIP
FENGFLSEILLQKGYNTYAIGKWHLTPADQISAAGPYDRWPLGRGFERFYGFLGGETHQY
YPDLVYDNHTVKPEKTPAEGYHLTADLADKAISFIADAKQVAPNKPFFMYFCPGAMHAPH
HVPKEWADAYAGQFHDGWEAYREKVFAHQQEMGIVPTDAELSRHDPDVPHWDSLSAAEKR
LYARMMEVYAGFLTHTDHHIGRLLDFLKAIGEFENTVIIVISDNGASSEGGPTGSVNENL
FFNNVPESLEENLKALDKLGSPETFNHYAWGWTWAGNTPFRRWKRETYRGGISDPLIVHW
NQGIEAKGEIRTQYAHAIDLVPTVLELLEIEPPTTIKGVTQSPIEGVSFAHTFNHSTVPT
KHLTQYFEMMGHRSLYYDGWRAVCPWPGPSFAEAGQFFGAAISAQTLTDLDTHHWELYHV
ASDFAENHNIAADNRPKLIEMIATWYVEAGKYNVLPVDGRGVQRFAEERPQIAVNRSRYT
YYPDTQAIPANSAVKLLNRSHSITADVEIPTGGAEGVLLAHGGNDSGYSFYVKDGKLHWV
HNYVARSLYHVESGSSVPEGRHQLRFEFKVTGQPDLAKGKGTPGRAELYIDGKLVGQADV
PVTTPLALGLTSGVTCGIAPGAPVTPDYEPPFKFTGKIYSVIVDVSGDLIQDKEAEMRTI
LARQ
Download sequence
Identical sequences K9PKN8
gi|427718563|ref|YP_007066557.1| WP_015129532.1.42896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]