SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9PKU7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9PKU7
Domain Number 1 Region: 111-228
Classification Level Classification E-value
Superfamily Cysteine proteinases 4.41e-36
Family NlpC/P60 0.00000131
Further Details:      
 
Domain Number 2 Region: 13-84
Classification Level Classification E-value
Superfamily Prokaryotic SH3-related domain 2.01e-24
Family Spr N-terminal domain-like 0.0000383
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K9PKU7
Sequence length 245
Comment (tr|K9PKU7|K9PKU7_9CYAN) NLP/P60 protein {ECO:0000313|EMBL:AFY34030.1} KW=Complete proteome; Reference proteome OX=99598 OS=Calothrix sp. PCC 7507. GN=Cal7507_3638 OC=Bacteria; Cyanobacteria; Nostocales; Rivulariaceae; Calothrix.
Sequence
MVTNQSTIQNHQSVEYNCLADLNLYNSPECQSLATQASAGRHLRITSNYQDAAVEVYLCE
DDYPGWVSLTNLDLLQPATLPYQARLWAESEIKKLLPEVISFTHKAMQQANYYLWGGTVG
PNYDCSGLMQTAFVSVGIWLPRDAYQQEGFTQPIAMTELAPGDLVFFGTPQKATHVGLYL
GDNHYIHSSGKTQGRNGIGIDVLSEMGDEVSRSYYQQLRGAGRVVKSYEPRGEAGGRAQG
AGGKS
Download sequence
Identical sequences K9PKU7
WP_015129837.1.42896 gi|427718870|ref|YP_007066864.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]