SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9PTF4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9PTF4
Domain Number 1 Region: 12-279
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 1.06e-26
Family Tryptophan biosynthesis enzymes 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K9PTF4
Sequence length 286
Comment (tr|K9PTF4|K9PTF4_9CYAN) Photosystem I assembly BtpA {ECO:0000313|EMBL:AFY36725.1} KW=Complete proteome; Reference proteome OX=111781 OS=Leptolyngbya sp. PCC 7376. GN=Lepto7376_0283 OC=Leptolyngbya.
Sequence
MYIQAKKKSVDLKHLFQTENPILGVVHLLPLPTSARWGGDLRKVFDRAEQEAAALAAGGI
DGIIVENFFDAPFTKGKVDPATISAMTLIMDRLAGLVTVPLGLNVLRNDAKSAMAIAACT
NAKFIRVNVLTGVMATDQGLIEGNAHELLKYRRELDADVAILADVLVKHAHPISTPNLTA
AIHDTVERGLADAVILSGWATGHAPKIDDIKDARENSGNTPILIGSGATWENIGNLLQVA
DGAIVASSLKRHGKISQPIDPLRVSQFMESAQQGIKIRQMRQQQFA
Download sequence
Identical sequences K9PTF4
gi|427722282|ref|YP_007069559.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]