SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9PUX5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9PUX5
Domain Number 1 Region: 12-412
Classification Level Classification E-value
Superfamily PLP-dependent transferases 8.51e-125
Family Cystathionine synthase-like 0.0000000000805
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K9PUX5
Sequence length 420
Comment (tr|K9PUX5|K9PUX5_9CYAN) Cysteine desulfurase {ECO:0000256|SAAS:SAAS00645443} KW=Complete proteome; Reference proteome OX=111781 OS=Leptolyngbya sp. PCC 7376. GN=Lepto7376_0164 OC=Leptolyngbya.
Sequence
MIVMPTKSLAAEVRDDFPILNQEVHGKPLIYFDNAATSQKPQAVLDALMHYYTSDNANVH
RGIHSLSSRATDAYEGARDKVAKFINATSRDEIVYTRNASEAINIVAYTWGLANLTAGDE
IILSVMEHHSNIVPWQMIAEKTEAVLKYVQLTNEEAFDFEHYESLLSERTKLVSVVHVSN
TLGNINPVEAIIKSARRFDAKVLIDACQSLPHMPIDVQAMDCDWLVGSGHKMCATTGIGF
LYGKKEILEAMPPFLGGGEMISEVYFDHSTYGELPHKFEAGTPAIGEAIALGAAVDYLSG
IGMERIQTYEAELTAYLFKKLADIPKLKIYGQQPDSKGHGRAALAAFNVEGIHANDLATL
LDHEGVAIRSGHHCTQPLHRLFEASGSARASLYFYNTFAEIDSFVAALKETIDFFTSMAE
Download sequence
Identical sequences K9PUX5
WP_015132396.1.56710 gi|427722166|ref|YP_007069443.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]