SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9PVQ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9PVQ6
Domain Number 1 Region: 75-357
Classification Level Classification E-value
Superfamily PLP-binding barrel 3.92e-61
Family Alanine racemase-like, N-terminal domain 0.0031
Further Details:      
 
Domain Number 2 Region: 457-574
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 0.000000523
Family Eukaryotic ODC-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K9PVQ6
Sequence length 642
Comment (tr|K9PVQ6|K9PVQ6_9CYAN) Biosynthetic arginine decarboxylase {ECO:0000256|HAMAP-Rule:MF_01417} KW=Complete proteome; Reference proteome OX=111781 OS=Leptolyngbya sp. PCC 7376. GN=Lepto7376_0167 OC=Leptolyngbya.
Sequence
MAISPSQSPDEHSWSVQDSERLYQIQGWGEPYFGINAAGHVQVAPTGEAEHGVDLFELVE
KLKNQGIQLPCLLRFPDILSDRLKRLNECFAQAIARYGYEGEYQGVYPIKCNQHRPVVEA
LLEAGQPYRFGLEVGSKPELMIAIAMLEPTSDHQPLLICNGYKDRDYIETALLATQLGHR
ALIVIEQPEELDLTLSASQALEIRPALGIRAKLASQGIGRWGSSSGDRAKFGLTVPQILQ
IVQTLRDKNSLDCLQLLHYHIGSQLSSIGVIKAAIREASQIYAELVLLGANVKYLDVGGG
LAVDYSGSKNNVPASKNYNMQNYANDIVATVKDSCDEKQVPAPTLVSESGRAIASHQSIL
IFDILSSSDITPTLPPEPSHREHLVIRNLRETYDFITLENYQETYHDAMQFKEEAISLFS
LGYLTLGDRGTAEQLYWCCCEKIFQIMQTAVSIPTDLQDLWQNMATIYYGNLSIFQSIPD
SWAINQLFPIMPIHRLDKRPNRRGIIADLTCDSDGRFNQFIDIKTKHKNLLELHPLNDKP
YYIGLFLMGAYQDIMGNFHNLFGRTNAVQVRLTEKGHSIDSMTQGSTVENILETVQYKHQ
ELLEKIKTQVDSAANRQKINIEQAQYLIDRYENNLKGYTYLN
Download sequence
Identical sequences K9PVQ6
WP_015132399.1.56710 gi|427722169|ref|YP_007069446.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]