SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9PVS2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9PVS2
Domain Number 1 Region: 1-320,433-474
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.23e-59
Family FAD-linked reductases, N-terminal domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K9PVS2
Sequence length 487
Comment (tr|K9PVS2|K9PVS2_9CYAN) 9,9'-di-cis-zeta-carotene desaturase {ECO:0000256|RuleBase:RU362008} KW=Complete proteome; Reference proteome OX=111781 OS=Leptolyngbya sp. PCC 7376. GN=Lepto7376_0182 OC=Leptolyngbya.
Sequence
MRVAIVGAGLAGLSTAIELVDAGHEVEIFEARPFVGGKVGSWVDKDGNHIEMGLHVFFGC
YYNLFALMEKVGAGNNLRLKEHTHQFINEGGKLGELDFRFPVGAPFHGLKAFFTSSQLSL
IDKAANSLALGTSPIVRGLVDFKGAMKTIRDLDRISFADWFRSHGGNDGSLKKMWNPIAY
ALGFIDTENISARCMLTIFMFFAAKTEASVLRMLEGSPAEYLHKPIVNYLESKGAKIHTR
HRMKDIHYTLDGTPTIDGLVINNGETDETVKADTYVLALDIPGIQRAVPDAWRKWPEFDN
IYKLDAVPVATVQLRFDGWVTELNDPEKRAQLEKAEGIDNLLYTHQADFSCFADLALTSP
GDFYKEGEGSLMQLVLTPGDPFIKKSNDEIAQHVLEQVHKLFPSSRELNMTWSNVVKLAQ
SLYREAPGMDPYRPAQDTPISNLFLAGSYTQQDYIDSMEGATISGRQAAEAILAKAGELE
KPLVATM
Download sequence
Identical sequences K9PVS2
gi|427722184|ref|YP_007069461.1| WP_015132414.1.56710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]