SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9PXH3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9PXH3
Domain Number 1 Region: 17-109,157-362
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.49e-31
Family Pancreatic carboxypeptidases 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K9PXH3
Sequence length 373
Comment (tr|K9PXH3|K9PXH3_9CYAN) Succinylglutamate desuccinylase/aspartoacylase {ECO:0000313|EMBL:AFY37813.1} KW=Complete proteome; Reference proteome OX=111781 OS=Leptolyngbya sp. PCC 7376. GN=Lepto7376_1470 OC=Leptolyngbya.
Sequence
MIPSIETIDLFQLASGDRLAIQVYKFVGAQPGAKVYIQANLHGCEIVGNAVVHQLIEYLS
DVDKGAIAGEIWLVPTCNPLGTNQRGHFYATGGFHSYSGEDWNRIFWEYEPTVDELSQFV
DKHLGSDEAEIIQAYRGQILAAFEKELAKQNHPCGVSVPEYFRGKLQCLCLDADYVIDIH
SSSNDGLDFVYYFPNRETQASWFNFDYSILLTQGGDYAFDEAFIWPWIVLEKAFAETGQK
IKLAVDGCTLELGSGMKMRPSSVAKGLASIKNYLAHRGILSAEIPEATTTKCLPSGNITR
YRATVGGMIGDRLPLGQAVKAGEKLYDILSFNRQGKLPKVTTINSMVDGIVFDLAISESA
NQGEYVMSVLETN
Download sequence
Identical sequences K9PXH3
WP_015133585.1.56710 gi|427723370|ref|YP_007070647.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]