SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9PYL3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9PYL3
Domain Number 1 Region: 2-250,353-418
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.95e-74
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.00000537
Further Details:      
 
Domain Number 2 Region: 442-575
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 5.89e-46
Family Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 0.00015
Further Details:      
 
Domain Number 3 Region: 227-349
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 4.64e-40
Family Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 0.0000437
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K9PYL3
Sequence length 575
Comment (tr|K9PYL3|K9PYL3_9CYAN) Succinate dehydrogenase subunit A {ECO:0000313|EMBL:AFY38565.1} KW=Complete proteome; Reference proteome OX=111781 OS=Leptolyngbya sp. PCC 7376. GN=Lepto7376_2275 OC=Leptolyngbya.
Sequence
MLQHDVIIVGGGLAGCRAALEIKKTNSNIDVGLIAKTHPIRSHSVAAQGGIAASLKNVDP
EDSWEAHAFDTVKGSDYLADQDAVEILTKEAPEVIIQLEHMGVLFSRLEDGRIAQRAFGG
HSHKRTCYAADKTGHAILHELVNNLRHNGVTIYDEWYVMNLIFEENQAKGLVMYHIETGK
LEVVCAKAVMFATGGYGRVFNTTSNDFASTGDGLAMTAAVGLPLEDMEFVQFHPTGLFPV
GVLISEAVRGEGAYLRNSDGDRFMEKYAPKQMELAPRDITSRAITLEIRAGRGIKPDGSA
GGNFVHLDLTHMGKDKIMSKVPFCWEEAERLVGIDAIVEPMPVRPTAHYSMGGIPVNTEG
RVRKNGTELTEGFFAAGECACVSVHGANRLGSNSLLECIVYGRRVGSKIAEYIGDRPLPD
ISEKDYLEAAKTRIKKLIDQTGKTRIGDLRQRFQDTMSEHCGVFRTDEIMSEGIQEIQSL
KAEYNDVFLDDKSTHWNTELIEAMELQSILKVGEAILTSAYNRKESRGAHSREDFPIRDD
KKYLGHTLSFCSEDGVDIEYMPVVVNRFEPKERKY
Download sequence
Identical sequences K9PYL3
WP_015134327.1.56710 gi|427724122|ref|YP_007071399.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]