SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9PZ99 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9PZ99
Domain Number 1 Region: 28-193
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 0.0000538
Family HD domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K9PZ99
Sequence length 320
Comment (tr|K9PZ99|K9PZ99_9CYAN) Uncharacterized protein {ECO:0000313|EMBL:AFY38139.1} KW=Complete proteome; Reference proteome OX=111781 OS=Leptolyngbya sp. PCC 7376. GN=Lepto7376_1811 OC=Leptolyngbya.
Sequence
MTHLKIQRSPQSFKDSVELMMGYVRHQMELETADKMLYFHNFAHVQGVRRRAELIFDAVR
PHWQAELNQLHDSLDLERMRGLLSLAAIAHDMVQEFLPLKPWQARRREMGVSENKTIDKL
LGAIAELNADLANQHPDRPELQFSDADCEVLREAISATICDFDPSDRAIFQPYLYTDEEK
SKVAVILALADIGALVVEGIDAFRQEGREIFLEENLDFVPLVLHPQEIEQYPHETKIALR
DNLLGRARFQIGFATGRINRLAVETSSLPAQSLVTLQNEVFSYANQRTLEELKTTTPTSS
DTSLEELLNYFRFDRIPVTL
Download sequence
Identical sequences K9PZ99
WP_015133908.1.56710 gi|427723696|ref|YP_007070973.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]