SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9Q192 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9Q192
Domain Number 1 Region: 31-343
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.22e-35
Family Filamentous hemagglutinin FhaB, secretion domain 0.0092
Further Details:      
 
Domain Number 2 Region: 482-651
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000000000753
Family iota-carrageenase 0.077
Further Details:      
 
Domain Number 3 Region: 351-473
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000847
Family Filamentous hemagglutinin FhaB, secretion domain 0.072
Further Details:      
 
Weak hits

Sequence:  K9Q192
Domain Number - Region: 652-764
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000173
Family Filamentous hemagglutinin FhaB, secretion domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K9Q192
Sequence length 1002
Comment (tr|K9Q192|K9Q192_9CYAN) Filamentous hemagglutinin family outer membrane protein {ECO:0000313|EMBL:AFY38532.1} KW=Complete proteome; Reference proteome OX=111781 OS=Leptolyngbya sp. PCC 7376. GN=Lepto7376_2242 OC=Leptolyngbya.
Sequence
MNCPSHPIKTTLLCFRWVALLMGVIVGTILPKVPSQAQLQPDNSLGTESSIVSLDNIING
GATRGSNLFHSFSDFNVNAGQSVYFANPVGIDNILSRVTGNNVSNIDGLLGVNGTANLFL
LNPNGIIFGENAALDISGSFTASTANSFQFTDGSEFQATPLAGELLSMSVPLGVQFNDQP
QGILTDKAGILVGSGSTLTLLGKKEESNKDTLLIRAEDLIIENTSTSNPTVPIISALTIE
EQLFSYAVILQAINTLTINSSVQGFRDNDLVLEASNIEINNELGQNNGGDIRLITPQIEG
NAISINGALVSTANGDETISGGNIGVITHDFTIQDDARLMVQTISDNGKGGGGIFIDASG
DLSVQTFSSIQSAALFGGAKSGVIDITADNLVVTDSSSISTSVDTFNNLGGFGNSGDINI
VAVNNLEVSDGSEILSQVSDGATGNGGFISITTPQLTVSEASFISTSTLGTGNAGNMLLN
VFGDVFVTEGGAIESQVANSAMGNGGRIDLIASSLNVIAGQINAATEGIGDAGNIVINTS
GDVTISEFSGLNSQAAFGSTGDGGTIEINARNLKIADESFLAASSLSDGDAGDISINVAE
DVSVTGFFSAIESQVAFENSLGDGGTIDINARNLEVADQAFLSVSSFGEGNAGNIIIDVS
ETVSVTGEFTFIESLVSGNGDGGSIEITTTELILSDGSLISASTSGSGDAGNLTILGRSP
LTLRGDGKLTVESLEATSGSAGTLTIGNASDLAIRDGIVLSAESASENGGGEIIIDIDNH
LFFTGGSLINAGSTNPNSGDGGNITIRLGNGFVITPPGQDNDIIANAVAGERGNIDITAL
QIFGFTEQEESRTELLRGNGSSDLGASGVITLSTLDLDPSQGLVELPAVLSDRTDQIAAG
CDLNHSEDQSEFVVTGRGGLPLNSSTLGNAAGVSVPWVIASDDESLALVGQQSSSASPTL
VEAQKVAIDTMGNLSFVVPQDSIAHSEIQASTSDFCQVNHQL
Download sequence
Identical sequences K9Q192
gi|427724089|ref|YP_007071366.1| WP_015134294.1.56710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]