SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9Q1Y6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9Q1Y6
Domain Number 1 Region: 22-165
Classification Level Classification E-value
Superfamily Multiheme cytochromes 4.01e-17
Family Di-heme elbow motif 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K9Q1Y6
Sequence length 215
Comment (tr|K9Q1Y6|K9Q1Y6_9CYAN) Doubled CXXCH domain protein {ECO:0000313|EMBL:AFY39171.1} KW=Complete proteome; Reference proteome OX=111781 OS=Leptolyngbya sp. PCC 7376. GN=Lepto7376_2919 OC=Leptolyngbya.
Sequence
MAQGVKKRFGWRSLMSLKVITIATCLALIGWFAAAFALNAKQVFIPGETSVGHYLFEASC
ASCHEGFKPVTNETCTRCHEAELEQDIHGTKKFRDPRWAGDLEKIEALTCTTCHAEHVHM
FDRGVNLQPDLCMACHEGIINGDLKSHDGFTPDGCWTAGCHNYHDHRTISTGFLRQNMGQ
PPMLPVQRVPDHSVDWTLDTAPKPDLSKEFLGGAS
Download sequence
Identical sequences K9Q1Y6
gi|427724728|ref|YP_007072005.1| WP_015134922.1.56710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]