SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9Q2J8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9Q2J8
Domain Number 1 Region: 14-266
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.36e-24
Family FAD/NAD-linked reductases, N-terminal and central domains 0.062
Further Details:      
 
Domain Number 2 Region: 200-239,272-394
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000000000596
Family FAD/NAD-linked reductases, N-terminal and central domains 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K9Q2J8
Sequence length 421
Comment (tr|K9Q2J8|K9Q2J8_9CYAN) FAD-dependent oxidoreductase {ECO:0000313|EMBL:AFY39309.1} KW=Complete proteome; Reference proteome OX=111781 OS=Leptolyngbya sp. PCC 7376. GN=Lepto7376_3069 OC=Leptolyngbya.
Sequence
MPFASLTDKKNLQQCDIAVVGAGVQSLTLVLHLLKKRPKLRQRITVFDPHGQWLANWHHQ
FAAQDISHLRSPAVHHPHPDPFALRRFAEKRANELFPPYDLPGTKLFADFCQAAIKEFQV
EKHVIPAAVTDLEPPTENQRKFTLTLDNGNQWVARRVVLATNRTQRQLPQWLDSIEMPYP
PDRLCHSDHVDLRGLHLKGERIIIVGGGLSTGHLALGAIARRGQVTMIARRAFQEKLFDA
DAGWMGPKYLKGFYAEPDWEKRLEMVLNARDGGSLTPMVMRQLRQAKRKDTITLKPECQI
QTARWQGNHWQLYCDNGEIVEGDRLWLATGSRFHLDAEPLLQKVRERHPQPSINGFPILD
KYLRWQGCDLFLMGGLVALQIGPTARNISGARIACDRLVPALTKSSLQRVYGGIGCNRVS
A
Download sequence
Identical sequences K9Q2J8
gi|427724866|ref|YP_007072143.1| WP_015135059.1.56710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]