SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9Q5D8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9Q5D8
Domain Number 1 Region: 16-123,201-308
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000000000374
Family FAD/NAD-linked reductases, N-terminal and central domains 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K9Q5D8
Sequence length 421
Comment (tr|K9Q5D8|K9Q5D8_9CYAN) Putative mercuric reductase {ECO:0000313|EMBL:AFY40588.1} KW=Complete proteome; Reference proteome OX=111781 OS=Leptolyngbya sp. PCC 7376. GN=Lepto7376_4485 OC=Leptolyngbya.
Sequence
MMWLGDRTRTRFNIVDYDLVIIGATQTGLVLAKKAIAQRLRVALVQQVAQPLQDIQLRAL
ERIVLGCAAHSSGEKLRQEISKAIASTDFYEPLVKLMDKGVDVIPEVGKFQIESNPIFVT
ETRTLKSKNYAITTSTVWEKSDDPKMLTLPDFLKPETWQSLNQTIIFKGITPELMTLAYG
LSQQGKKIQLLLGAQFFGTEDQQLTHRLQTFLEVAGIEVYRNTSITEQAEFLQQENAYII
DSDLLQGKINSLNLSPKHFRTQKSYLKVNHKLQTSTLNIYGCGSILGGYDLPELAIAEAD
FLIQSLIHKKRPISPYPLTPYRLFEPYPFDHVGYQGKYLPPDAITQEKTFFLDYVDQLRF
PMDLTIKLWLTVDQKMLGATVLGDHSGKLIYACRDLIKTKQPFQSWDNLLEYAGIAAEIC
W
Download sequence
Identical sequences K9Q5D8
gi|427726145|ref|YP_007073422.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]