SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9Q914 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9Q914
Domain Number 1 Region: 7-269
Classification Level Classification E-value
Superfamily Pentein 3.73e-53
Family Dimethylarginine dimethylaminohydrolase DDAH 0.022
Further Details:      
 
Weak hits

Sequence:  K9Q914
Domain Number - Region: 618-700
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 0.00336
Family Pyruvate oxidase and decarboxylase, middle domain 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K9Q914
Sequence length 703
Comment (tr|K9Q914|K9Q914_9NOSO) Uncharacterized protein {ECO:0000313|EMBL:AFY41636.1} KW=Complete proteome; Reference proteome OX=317936 OS=Nostoc sp. PCC 7107. GN=Nos7107_0975 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Nostoc.
Sequence
MNSRIRFLMCPPDHYDVDYVINPWMEGNIHKSSRDRAVEQWQGLYQILKEHAIVNLVTPQ
KGWPDLVFTANAGLVLGDNVVLSRFLHKERQGEEPHFKQWFEENGYTVYELPKDLPFEGA
GDALLDREGRWLWAGYGFRSELDSHPYLAKWLDIEVLSLRLIDERFYHLDTCFCPLANGY
LLYYPGAFDSYSNRLIEMRVAAEKRIAIAEADAVNFACNAVNVDSIVIMNKASEALKSRL
AEVGFRVLETQLTEFLKAGGAAKCLTLRVTEPVRDEIHANVSVESRIIRLEGHLLDSGLI
NRALDLIVDTGGSFQVLNFNLGEQRQSTSAAEVKVSAPSHEVMEEIISLLIDLGAVDLPQ
DERDAKLEPVIMAGVAPDDFYVSTIYPTEVRINGQWVKVENQRMDGAIAITQNAHGIVAR
CKILRDLEIGEQVVVDVLGIRTIRKTESREQRNSQEFSFMSAGVSSERRVELVVEQVAWE
LRKIRDAGGKVVVTAGPVVIHTGGGEHLSQLIREGYVQALLGGNAIAVHDIEQNMMGTSL
GVDMKRGVAVRGGHRHHLKVINTMRRHGSIAKAVEAGVIKSGVMYECVHNNVPFILAGSI
RDDGPLPDTQMDLIKAQEEYAKHLEGAEMILMLSSMLHSIGVGNMTPAGVKMVCVDINPA
VVTKLSDRGSVESVGVVTDVGLFLSLLIQQLDKLTSPYRAVVG
Download sequence
Identical sequences K9Q914
WP_015111872.1.60169 gi|427706409|ref|YP_007048786.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]