SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9QB98 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9QB98
Domain Number 1 Region: 267-608
Classification Level Classification E-value
Superfamily ARM repeat 2.88e-37
Family PBS lyase HEAT-like repeat 0.0053
Further Details:      
 
Domain Number 2 Region: 9-156
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000000549
Family SMI1/KNR4-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K9QB98
Sequence length 608
Comment (tr|K9QB98|K9QB98_9NOSO) Cell wall assembly/cell proliferation coordinating protein, KNR4 {ECO:0000313|EMBL:AFY42406.1} KW=Complete proteome; Reference proteome OX=317936 OS=Nostoc sp. PCC 7107. GN=Nos7107_1770 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Nostoc.
Sequence
MSLLTDALDRIETWLVKNQPEFALSLAPGLTRQEIDAIVENFPYRLPEELYEFYGWHNGC
QYGYIVPKFDNFFSLQEALKWYADFLSWGFDWNPHWLTILDFNGDYRYAVVTGEDSAPIW
FIDPEGCIKEIRWDSLTDLMLATAECYETGAYYFDDEGYIKEDKQKVAEIHRKYNYRGRE
TSTTNESYNPEPPTVASEVDLSNPNALEELIQALQAAPLSPDAGMLQAMAANTLDNLANL
GLVNQVGAEPLVIGLQNILYDNAGHALAAKKLGELGDIRAVEPLLQALSHPSGKVRTNAI
ESLVKLGDSRAVEPLIQCLQDSDFFVRTKAAWALAEFGDTKAIEPLIEALSHENQSTACG
AIASALGKFGDVRAIEPLIAVFRSNGSFLRDAFSFPHVQLAVVHALRLIDDSRTTDILVE
FLRDREGLLQAINRDWLRSEQATHQVIETLLTRQHPDLLEILTQLLQASESRIQTNTLSA
IAKITNPLMIDLLILTLANENNWLRKSAIYYLGERVDTRAIEPMISILQDVNADVRITAV
YALAKMNDERVVKALIEMLKDEDFRVRGAAALNLGNLGNLRAVEPLNQCLEDENSIVRKI
VQQALNKL
Download sequence
Identical sequences K9QB98
gi|427707179|ref|YP_007049556.1| WP_015112626.1.60169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]