SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9QGW2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9QGW2
Domain Number 1 Region: 14-320,367-397
Classification Level Classification E-value
Superfamily Pectin lyase-like 8e-41
Family Filamentous hemagglutinin FhaB, secretion domain 0.0092
Further Details:      
 
Domain Number 2 Region: 398-536
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000021
Family Filamentous hemagglutinin FhaB, secretion domain 0.052
Further Details:      
 
Domain Number 3 Region: 539-632
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000377
Family Filamentous hemagglutinin FhaB, secretion domain 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K9QGW2
Sequence length 892
Comment (tr|K9QGW2|K9QGW2_9NOSO) Filamentous hemagglutinin family outer membrane protein {ECO:0000313|EMBL:AFY44396.1} KW=Complete proteome; Reference proteome OX=317936 OS=Nostoc sp. PCC 7107. GN=Nos7107_3836 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Nostoc.
Sequence
MRFWRWNCTAILWLLACNQAVADIIPDNTLPVNTTVSNSGNIRMIEGGTLRDTNLFHSFQ
EFSFSVNTAATTGDTAFFNNNSAVINIFARVTGGSISNIDGIIRANGTANLFLINPSGIV
FGPNASLNVGGSFIASTANSIKFADGKEFSATNHTPDPLLTVSIPIGLNFSSTVGRIVNQ
SQASPNGEMTDADPSNPIGLKAPIGKTLALIGGDVGIEGGNLTTTAGRIELGSVGTGLVK
LTEIEKGYAFDYSGVQDFRDIQVSQFAIIYGSGNDGSDIHFQGRNVNLTDSSLVFINSFE
RGRQDNLSINAKNLTIDSGAFLGTFALGDGNAGNILVKASELVELAGTTPDGFIPSGIGS
QVIELATGNAGNIKIETKQLLIRDGATVDSSTFGLGNAGNINVKASDFIELRGGSQDGQI
ASGIVTQVVQDAVENPGNAGALTIETQKLTITGGAQIATTARNSGNGGNITIHATDKILV
SGASSQATGSSFDSYRSGIFVGSDPGATGDVGNLDITTGLLTVENGARISAANFGSSQVG
GNATFTLRQLVVQNGGEIRSASFGEGAGGTLNINATDSVEVVGAANIGGESVISTLFTDA
QASGKAGNLIINSDHLSVRDGAELSVSSEGSGQAGNLDITARIVQLDNQAKLIAETASGD
GGNITLTLDEVLLLRRQSLISTTAGTLPAGGNGGIINIKAPFIVAISSENSDIKANAFTG
NGGQVNITTQGIFGIQPRQFPTPESDITASSTFGVNGVININNPDVDPTQGLTTLPQTVV
DVSQLIAQGCGTQTEQVANQFTVAGRGGLPPSPNDQLDSDAVWSDTRRTVAAKPQYQSKI
PAVQVSKTLNSLFLVPASGWVFNNKGEVTLVAQGANSVRENLGVTSTVCHSR
Download sequence
Identical sequences K9QGW2
gi|427709169|ref|YP_007051546.1| WP_015114598.1.60169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]