SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9QLK8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9QLK8
Domain Number 1 Region: 781-1099
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 3.92e-45
Family Integrin alpha N-terminal domain 0.011
Further Details:      
 
Domain Number 2 Region: 451-769
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 7.19e-42
Family Integrin alpha N-terminal domain 0.019
Further Details:      
 
Domain Number 3 Region: 175-493
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 1.11e-41
Family Integrin alpha N-terminal domain 0.019
Further Details:      
 
Domain Number 4 Region: 1637-1806
Classification Level Classification E-value
Superfamily beta-Roll 1.22e-22
Family Serralysin-like metalloprotease, C-terminal domain 0.00047
Further Details:      
 
Domain Number 5 Region: 1477-1662
Classification Level Classification E-value
Superfamily beta-Roll 5.36e-21
Family Serralysin-like metalloprotease, C-terminal domain 0.00071
Further Details:      
 
Domain Number 6 Region: 1388-1518
Classification Level Classification E-value
Superfamily beta-Roll 0.0000214
Family Serralysin-like metalloprotease, C-terminal domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K9QLK8
Sequence length 1829
Comment (tr|K9QLK8|K9QLK8_NOSS7) VCBS repeat-containing protein {ECO:0000313|EMBL:AFY45959.1} KW=Complete proteome; Reference proteome OX=28072 OS=Nostoc sp. (strain ATCC 29411 / PCC 7524). GN=Nos7524_0032 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Nostoc.
Sequence
MTYPRFLNIIANLFGLTDVGLVAAPTFADIDGDGDLDAFVGNNSGNTLFYQNTGTVTNPQ
FAAPSTNPFGLTNVGLYAAPTFADIDGDGDLDAFVGNRSGNTLFYQNTGTATNPQFAALT
TNPFGLTNVGLYAAPTFADIDGDGDLDAFVGNLDGNILFYRNIGTASNTRFADPSTNPFG
LTDVGFNAKPTFADIDGDGDLDAFVGNLDGNTLFYRNIGTATNPQFASPTTNPFGLTDVG
LVAAPTFADIDGDGDLDAFVGNLDGNTNFSRNQPFSSPNINFHPPTTYPFGVTDVGLYAS
PTLVDIDGDGDLDAFVGNFDGNTLFYRNIGTATNPQFNTPTTNPFGLTDVGYLASPTFAD
IDGDGDLDAFVGNFDGNILFYRNIGTATNPQFASPTTNPFGLTDVGYFAAPTLADIDGDG
DLDAFVGNLDGNTLFYRNIGTANNPQFAAPTTNSFGLTDVGYFAAPTFADLDGDGDLDAF
VGEGEGNTLFYRNTGTARNPQFVTPSTNPFGLADVGRYAKPTFADIDGDGNLDAFVGNGD
GNTNFSQNQPAFPPSINFLPRSTNPFGLTPLESYSTPTFADIDGDGDLDAFVGNRDGNIL
FYRNIGTATKPQFDTPTPNSFGLTDVGFYAAPTLVDIDGDGDLDAFVGNSEGNTLFYRNI
GTATNPQFAAPTTNPFGLTDVGYLAKPTFADIDGDGDLDAFVGNRDGNILFYRNIGTATN
PQFASPTTNPFGLTGVGSFAAPTFADIDGDGDLDAFVINVDSNILFYRNIGTASNPQFDT
PTPNSFGLTDVGLNAALTFADIDGDGDLDAFVGERYGDTAFYQNQPAPPTPINFRPPSTN
SFGLTDVGFSAVATLADIDGDGDLDAFVGNFDGNILLYRNTGTATNPQFATPINNPFGLT
DVGFNAAPTFADIDGDGDLDAFVGHFDGNTMFYRNTGTATNPQFAAPTNNPFGLSDVGFN
AVPTFADIDGDGDLDVFVGNFDGNILLYRNTGTATNPQFAAPTTNPFGLTNVGTFAKPTF
ADIDGDGDLDAFVGNGDGNTLFYRNTGTATNPQFNTPTTNPFGLTDVRAGAAPTLVDIDG
DGDLDTFVGNSDGNTLFFLNIPNTPPTAANDAVSINENTLLNGNVLTNDSDLDGSPLTVT
QVNGSAANVGQEIILGNGKLRVNANGSFTFDPTNGTPALTDGYDYLAQGVTATASFTYTI
SDGNGGTANATTIITITGVNDVATITGTATGTVTEDASTPNLTTTGTLTVTDVDTGENNF
NTTIAGTGNIGSLTITTAGTWNYTVANSAVQSLGAGDSKTETFTVQSVDGTASQEITVTI
NGVNDHPIASDDNRITNFNTPLFIPVSDLLLNDSDIDGDSLSIINTLNATNGTAVLNNGV
IEFTPTTDFIGNASFDYTVSDGFGGTDIGTVTVTVQSNRIIGTPGNNNLTGTASNDLIEG
LEGNDTLDGGAGNLDRIFGGDGDDRITDSDGVNGAHGSPGNDVINITFAASWDNDTNPNN
APRSDGKITGGFGNDVITVTMNNSNFFINLKGDEPTSNQPQDGNDVVTLLGSYAHSVVDM
GGGNDIFNGGVGNDNVSGHNGNDTLNGNAGNDTLYGGAGLDWLDGGTGADMMVGGSGMDI
YFVDNPQDIIIEEADGGIDTVIASISWQLGSHLENLTLTGTNAINGTGNSSNNVLIGNSA
GNILSGGNGNDWLSGLGGNDRLLGENGNDTLLGGNGDDVLVGGLGSDVLNGGDGSDRFVY
NTISDRGTLAAGDTINGFSTISDKLDLTQLLPTLIGYSGNVLGYLQFTQSGANALVQIDA
DGGGNSFVNLSTLTNVSAASLVVGTNVLV
Download sequence
Identical sequences K9QLK8
WP_015136429.1.5551 gi|427727319|ref|YP_007073556.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]