SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9QPH9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9QPH9
Domain Number 1 Region: 301-487
Classification Level Classification E-value
Superfamily TPR-like 3.98e-42
Family Tetratricopeptide repeat (TPR) 0.00096
Further Details:      
 
Domain Number 2 Region: 100-214
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 0.00000000837
Family Integrin alpha N-terminal domain 0.021
Further Details:      
 
Weak hits

Sequence:  K9QPH9
Domain Number - Region: 214-251
Classification Level Classification E-value
Superfamily PHL pollen allergen 0.0955
Family PHL pollen allergen 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K9QPH9
Sequence length 492
Comment (tr|K9QPH9|K9QPH9_NOSS7) Cytochrome c biogenesis factor {ECO:0000313|EMBL:AFY46979.1} KW=Complete proteome; Reference proteome OX=28072 OS=Nostoc sp. (strain ATCC 29411 / PCC 7524). GN=Nos7524_1086 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Nostoc.
Sequence
MKIHQAFQCFLPLASIAINLLTLLAIDLPAFSFTPSLDYSLSSQDWMQKYSTRSIQQLGS
VTPQRQLYIYETIQYHAYALWASLDQRILLEVKSKLGSSDTVLTLMDNNHDGKPDEWIHH
PSGDYDSPDFGFMFDLNQDGKMDYFVFNGGPLFVKEETQNADKIFPGLFWMNYHWIDSNY
DGHIDIMVFNDIDLDGDGYPDQGITAWVYDDDFDGRVDRTEYLGYTPWFPMNTQYGQLWK
PEKNQPLKKPVEPKEGEFIIQRSVKNINPRVFNKQFDIRKTELVSEINSVVSKLPVSKGI
NSSEAAIYFNLGMALFYEEKWQEASTAFQNVISLDIQHTKSYFMRGRANLYLKNYAEAIQ
DYRQVIKLEPNNDEAHYLLGYTLTRTNNLEEAIAAYRQTIKLNPRHAHAYNNLGSIFGRQ
GRYNEAIQVLQQSIQLDPKNTPAYFNLGRALYETGRYEQAVEYFRQALKLEPNYSSAQEY
LERTLQRLGRDQ
Download sequence
Identical sequences K9QPH9
WP_015137435.1.5551 gi|427728339|ref|YP_007074576.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]