SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9QV50 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9QV50
Domain Number 1 Region: 960-1176
Classification Level Classification E-value
Superfamily beta-Roll 3.79e-27
Family Serralysin-like metalloprotease, C-terminal domain 0.00069
Further Details:      
 
Domain Number 2 Region: 843-1008
Classification Level Classification E-value
Superfamily beta-Roll 1.83e-21
Family Serralysin-like metalloprotease, C-terminal domain 0.0013
Further Details:      
 
Domain Number 3 Region: 771-889
Classification Level Classification E-value
Superfamily beta-Roll 3.79e-21
Family Serralysin-like metalloprotease, C-terminal domain 0.00068
Further Details:      
 
Domain Number 4 Region: 670-753
Classification Level Classification E-value
Superfamily beta-Roll 0.0000000000000129
Family Serralysin-like metalloprotease, C-terminal domain 0.001
Further Details:      
 
Domain Number 5 Region: 260-532
Classification Level Classification E-value
Superfamily Tricorn protease N-terminal domain 0.00000000000124
Family Tricorn protease N-terminal domain 0.027
Further Details:      
 
Domain Number 6 Region: 546-663
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 0.0000188
Family DPP6 N-terminal domain-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K9QV50
Sequence length 1183
Comment (tr|K9QV50|K9QV50_NOSS7) Ca2+-binding protein, RTX toxin {ECO:0000313|EMBL:AFY48677.1} KW=Complete proteome; Reference proteome OX=28072 OS=Nostoc sp. (strain ATCC 29411 / PCC 7524). GN=Nos7524_2859 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Nostoc.
Sequence
MFTTNNSNDKLSQAVTEGSTNRGILFMDGAVENYSSLVTGVLPGFEVIILDSTQDGVEQI
TQVLSQRQGIDSVHIVSHGSCGSVQLGTANLSWDTLSFYASQLQSWQNALTDAAQILLYG
CNVAAGAVGKAFVQRLSELTSSVVAASDDLTGNAALGGDWELEVQTGCDAVTLAFSQASI
EAYEGVLNSQPYLVTDINLGNFFSPNYLTNVNGTLYFEAYTPTYGRELYRLDNTTGNAVR
LTDINPGARNSSPYNLTNINGTLYFVAENRTYGRELYRLDNTTGNAVRLIDINPGAGSSR
PEALRYINGTLYFEAYTSTYGRELYRLDNTTGNAVRITDINPGAGDSNPYELTEINGVLY
FRAYTSTYIYDLYRLDNTTGKAVRVTDSNTGDGLSFSQELTNINGTLYFTAVNTLDSYRN
FKLYRIDNTTGNAVVIDINAGANSSDPYRLTNINGTLYFTTSYGIYRIDNSTGNPVPVTD
NNFGNVSAAPYQLIYINGTVYFRAYNFTYGHELYRVDNSTGKAVLVTDINPGVESSHPDT
LTNINGTLYFTASTPTFGRELYRVDNSTGKAVLVTDINPGVESSHIDNLTNINGTLYFTA
STPTFGRELYRVDNSTGKAVRITDINPGAGDSYPGYLTYFNGILYFRASDSTLAYQLWAL
PIEAANQNEITGTSASETLNGTANPDIIYALEGDDKLYGFVGNDTLYGGTGNDWLDGGAG
ADEMIGGSGNDIYFVDNPQDTIIEDANGGIDAVISTISWELGNHLENLTLTGNNTINGTG
NSGNNVLIGNSAANILSGGDGNDWLSGGAGNDTLYGETGNDTLYGGTGNDWLDGGAGADE
KIGGSGNDIYFVDNPQDTIIEEANGGIDAVISSISWQLGNHLENLTLTGSNAINGTGNGG
NNVIIGNSAANILSGENGNDWLSGLGGNDRLLGGNGNDTLDGGTGDDWLDGGAGADEMIG
GSGNDIYFVDNPQDTIVEYANGGTDAVISSISWQLGNHLENLTLTGSNAINGTGNGGNNV
IIGNSAANILSGENGNDWLSGLGGNDRLVGGHGNDTLDGGTGDDTLIGGRGLDDLIGGAG
KDSFQLSLPVVGDFDTIADFSVADDKILISKAEFGLTQALGVLDASVFRLGTSAVTAGDR
FIYDQSTGNLFFDTDGLGGNTQVQIARLSNQAVLNNTHITVIA
Download sequence
Identical sequences K9QV50
gi|427730037|ref|YP_007076274.1| WP_015139115.1.5551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]