SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9QZG1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9QZG1
Domain Number 1 Region: 618-932
Classification Level Classification E-value
Superfamily DNase I-like 2.09e-30
Family DNase I-like 0.049
Further Details:      
 
Domain Number 2 Region: 1102-1255
Classification Level Classification E-value
Superfamily beta-Roll 6.28e-30
Family Serralysin-like metalloprotease, C-terminal domain 0.00076
Further Details:      
 
Domain Number 3 Region: 993-1114
Classification Level Classification E-value
Superfamily beta-Roll 3.01e-18
Family Serralysin-like metalloprotease, C-terminal domain 0.0012
Further Details:      
 
Domain Number 4 Region: 238-344
Classification Level Classification E-value
Superfamily CalX-like 0.0000392
Family CalX-beta domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K9QZG1
Sequence length 1262
Comment (tr|K9QZG1|K9QZG1_NOSS7) Putative extracellular nuclease {ECO:0000313|EMBL:AFY50182.1} KW=Complete proteome; Reference proteome OX=28072 OS=Nostoc sp. (strain ATCC 29411 / PCC 7524). GN=Nos7524_4424 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Nostoc.
Sequence
MTAIILKSEDIAIATNGLETVFTLPTGVISLSTPYFQDFDSLSTSNTAWTDNQTLTGWYT
SRTTINAGTGSSNTGSLYSFGASGNSDRALGSVASGGTGTIFYGARFFNDTGTTVTSLSI
SYVGEQWRNGGNTTQHKLDFAYQIGATSINTGTWIDVDSLDFIGPVATSTAGAVNGNDSS
NRVSLSGTMTGFSLAPGEEIWLRWSDVDNAGADHGLGIDHLQVATAALPGVTLVESGGST
NVTEDGATDTYTIVLNTQPTADVIVTITPDSQTTTSITALTFTPDNWNTAQTVTVTAVDD
ALVEGTHTSIINHSVVSNDTNYNGINIGSVTATITDNDVALTITKIHQIQGSGSAFNSAF
GGIRTIEGIVVAAFPGGTGLSGFFVQEEDADADDNSTTSEGIFVFDPTGRFSGNVGDKVR
VTGTVSEFTSGGNTSSLTQLSQVSSVINLGADVLPTVTTIQLPVASVVDWESYEGMLVNI
SAASGDLTVTEHFQLGRFGQVVLSATGASNQPGTDARLEQYTQFNDPSVAGYAAYLEEIA
KRRIILDDGSNVQNPATIIFGRGGEPLSATNTLRGGDTVVSITGVLDQRFEGYRVQTSTG
VNFTPANPRPETTPDVGGTLKVASFNVLNYFNGDGIGGGFTSPEQRGAENLTEFNRQRDK
TIAAILGLNADVVGLIEIENDGYGATSAIQDLVNGLNAVAGAGTYAFIDPGLPRLGTDAI
AVGFIYKPNSVTPVGAAATVPDGFGQGAFDNNNRKPLAQTFLQNSTGEQFTAVINHFKSK
GSSSGGIGDADAGDGQGLSNGTRTRASEDLAAWLATNPTGTTDTDYLIMGDINAYAQEDP
IKVLENVGYTNLVPNSSYSYVFNGQWGSLDHALANGSLAAQVTGAAKWHINADEPNVLDY
NTNFKSAAQINNLYHPDAFRSSDHDPVVVGLNLNTAPVAGNDTAITNQNTSININVLAND
SDFNGDPLQLSLVSTPVNGVALINDNGTPTDFNDDLITYTPNSGYVGSDSFTYAISDGKG
GTATASVSVTIKPTGGIIGTPGNNILIGTNRNDLIWGLGGNDTLLGGNGHDTLYGGDDND
LLVGGQGKDTLYGDNGNDTLLSGNGNDTLYGGNGNDILYSGNGNDTLYGGDGNDTLIGGN
GDDLLVGGQGYDLLTGGNGRDRFYLSDTRTGEFDTITDFKVGQDLILISKLEFGLIQALG
KLDPGLFRLGSSAVTASDRFIYDKTTGQLFFDEDGIGSTAQVQIGFLSNQAALTRSSITV
IA
Download sequence
Identical sequences K9QZG1
gi|427731542|ref|YP_007077779.1| WP_015140592.1.5551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]