SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9R110 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9R110
Domain Number 1 Region: 146-426
Classification Level Classification E-value
Superfamily Subtilisin-like 8.12e-83
Family Subtilases 0.00000385
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K9R110
Sequence length 616
Comment (tr|K9R110|K9R110_NOSS7) Subtilisin-like serine protease {ECO:0000313|EMBL:AFY51019.1} KW=Complete proteome; Reference proteome OX=28072 OS=Nostoc sp. (strain ATCC 29411 / PCC 7524). GN=Nos7524_5296 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Nostoc.
Sequence
MRKLIILCLFVIGLVSAVFGFLNFQGLAAKGEFETILLDFREDIPAEVIKQDLQAIAQKY
NVTPQLDNKFSAQDNVYIIKGDRDRLKELKKSPFAKATEIIEPNYIYKLIEPAAKPTWLG
ELLRPQDSEEVQPSLTAPNDEYYSKQWNLHKIGVESAWSQTKGSGVTVAVIDTGVTKVRD
LYETKFVKGYDFVNDKEEASDDNGHGTHVAGTIAQATNNKYGVAGIAYEAKLMPLKVLSA
YGGGTVADIAEAIKFAADKGADVINMSLGGGGESQLLKQAIDYAHSKGVVIIAAAGNENE
NSAAYPARYPYVIGVSAFGPDGEKAPYSNFGAGVDISAPGGTDAGAILQETINEEGESVF
LGLQGTSMASPHVAGVAALVKAKGIQEPEEILKVLKQSARVIKDDSLNYYGAGQLNAEAA
VKLATDGQISFQDFFRWLRDNGYLNPGFWIDGGAVALLPKILMVVGSYLLAWFLRVYFPF
AWSWSLSSGLIFGSSGLFFLQGIYIFDLPQWPFRVLGSSIPELGNTIQGTGALNPIFASV
LIPIVLMALLLGHPNWKWFAIGSTLGVAACLTVSAVLDPAVWGLGSENLARIFLIANALL
CYGLARLALKNEGQTA
Download sequence
Identical sequences K9R110
WP_015141423.1.5551 gi|427732379|ref|YP_007078616.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]