SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9R155 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9R155
Domain Number 1 Region: 721-896
Classification Level Classification E-value
Superfamily beta-Roll 3.01e-22
Family Serralysin-like metalloprotease, C-terminal domain 0.00098
Further Details:      
 
Domain Number 2 Region: 619-727
Classification Level Classification E-value
Superfamily beta-Roll 8.76e-20
Family Serralysin-like metalloprotease, C-terminal domain 0.0013
Further Details:      
 
Domain Number 3 Region: 385-411,493-557
Classification Level Classification E-value
Superfamily beta-Roll 4.58e-16
Family Serralysin-like metalloprotease, C-terminal domain 0.00096
Further Details:      
 
Domain Number 4 Region: 555-619
Classification Level Classification E-value
Superfamily beta-Roll 0.000000000000706
Family Serralysin-like metalloprotease, C-terminal domain 0.0012
Further Details:      
 
Domain Number 5 Region: 45-157,186-363
Classification Level Classification E-value
Superfamily NHL repeat 0.000034
Family NHL repeat 0.017
Further Details:      
 
Weak hits

Sequence:  K9R155
Domain Number - Region: 386-491
Classification Level Classification E-value
Superfamily CalX-like 0.000144
Family CalX-beta domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K9R155
Sequence length 905
Comment (tr|K9R155|K9R155_NOSS7) Uncharacterized protein {ECO:0000313|EMBL:AFY51151.1} KW=Complete proteome; Reference proteome OX=28072 OS=Nostoc sp. (strain ATCC 29411 / PCC 7524). GN=Nos7524_5434 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Nostoc.
Sequence
MVLNNSDVAKTLLDVKLEGQTTFITGFVPAGAAGTVDSNQTALGGLSGVVYDAVNNVYYS
LSDARSDSNGLARFYTFTTNLDNISTPQVTFTNATPLKDINGNFFAANSLNPEGFALIQN
STVFISSEGEVNINAGIKIDPFIKEFNLSTGQEVRSLPIPTNFLPVIVDTNNSGTINTGD
TQTSGVHNNLAFESLTITPDQNTLYTATETALFQDSPLTSDRIRRSRIIQYNLVSGQPEK
QYLYITDPAAELPTPTRPLTGNGLVDLLAIDNRGTLLALERSVSSGIAGANPSYTIKLYE
VKLQGATDISSQNTLPSDIAAIQPVQKRLLLTLDPNSSVGNVEGLAFGPTLQDGRQSIVL
VADNNFNTSTQILILSAQVNTISATITQSSGNIGVTEGGATDSYTVILTSQPTADVTITI
NPDTQLTTSSTTLIFTPQNWNVAQIVTVTAVDDAVLENTHTGTIQHTTSSNDSNYNSISI
ASVNVNITDNDPSPPTIQGTSLKDILKGTAGDDVIDAGDGNDYLMGNAGNDILDGGTGND
YLFGGAGDDILIGGAGAGFDLLYGNDGNDTLDGGEGNDNLDGGTGNDSLVGGTGNDIYIV
DSFGDTVVEMEGEGTDKVNSYINYTLGDYLENLTLLGNATIGTGNTENNHIIGNNANNTL
YGLEGNDWLMGQSGNDSLEGGNGSDRLDGGTGNDTLIGGLGNDTYEVDSINDVITESANE
GIDTVISIVDWTLDEHLENLSLVGNQAIDATGNGADNRLMGNSADNILRSLDGNDYLSGG
AGNDTLIGGFGNDTLVGGRSADIFDLSGVLFGGFDTIVDFKPGEDIVHLDAFEFKLTAGA
LDANWFVLGTSATTESERFIYNQARGELFFDTDGVGGAAQVKIAQFSNRVALSSNDFVLI
DSFLN
Download sequence
Identical sequences K9R155
gi|427732511|ref|YP_007078748.1| WP_015141552.1.5551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]