SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9R630 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9R630
Domain Number 1 Region: 2-231
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 1.06e-67
Family Decarboxylase 0.00000488
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K9R630
Sequence length 235
Comment (tr|K9R630|K9R630_9CYAN) OMP decarboxylase {ECO:0000256|HAMAP-Rule:MF_01200} KW=Complete proteome; Reference proteome OX=373994 OS=Rivularia sp. PCC 7116. GN=Riv7116_0292 OC=Bacteria; Cyanobacteria; Nostocales; Rivulariaceae; Rivularia.
Sequence
MQKIIVPLDVANESDALTLIEKLKEVTFFKVGLELFTSCGPKIIKLLKSRQKKIFLDLKF
HDIPNTVKGGCRSAGRYGVDLLTIHAAAGKDALKAATEGLAEGAMQAGVEPPKLIAITLL
TSISSRQLAFDLKVPLELPEYALQMALLAKECGLNGAVCSPQEAAHLRDVCGDDFLLVCP
GVRPTWADKGDQKRTFTPAQALQAGADYLVIGRPITAADRPVLAWKKICEELTSS
Download sequence
Identical sequences K9R630
gi|427733899|ref|YP_007053443.1| WP_015116474.1.44015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]