SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9R702 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9R702
Domain Number 1 Region: 93-220
Classification Level Classification E-value
Superfamily CheY-like 8.4e-42
Family CheY-related 0.00028
Further Details:      
 
Domain Number 2 Region: 228-402
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 7.85e-34
Family HD domain 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K9R702
Sequence length 408
Comment (tr|K9R702|K9R702_9CYAN) Response regulator containing a CheY-like receiver domain and an HD-GYP domain {ECO:0000313|EMBL:AFY53129.1} KW=Complete proteome; Reference proteome OX=373994 OS=Rivularia sp. PCC 7116. GN=Riv7116_0533 OC=Bacteria; Cyanobacteria; Nostocales; Rivulariaceae; Rivularia.
Sequence
MIQWKSNYTGSTELKVAGSNPTNRYNRVGKNHALPTESERHSSELSTHDLKVQQTDSEDS
SNYGLKNTNSNLLFSATLQNKEYSLDCFENDVPKVLVVDDHAASRMTAVALLGMEGYEVI
EAESGSVAVHLVSEKQPDLILLDVMMPEMDGFEVCQLLKQDEQTRLIPVIFITALNDRRS
RIRGIEVGADDFLSKPFDRVELAARVKSLVRQKRLNEDLDHAEKALFSIARAIESRDPNT
GDHCERLVNLGKAFGEYLGLSRNQVRDLMWGGYLHDIGKVGISDSVLLKKGKLTPAEWEE
MRQHVLIGEQICQPLRSMRGVIPIIRSHHERWDGSGYPDGLKENEIPLLAQVFQMIDIYD
ALTSERPYKKAFTPTEALSIMMEETDKGWRDKKLMQQFTEFISTINHS
Download sequence
Identical sequences K9R702
gi|427734132|ref|YP_007053676.1| WP_015116707.1.44015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]