SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for K9R991 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9R991
Domain Number 1 Region: 263-519
Classification Level Classification E-value
Superfamily PP2C-like 1.31e-44
Family PP2C-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K9R991
Sequence length 809
Comment (tr|K9R991|K9R991_9CYAN) Serine/threonine protein phosphatase {ECO:0000313|EMBL:AFY53672.1} KW=Complete proteome; Reference proteome OX=373994 OS=Rivularia sp. PCC 7116. GN=Riv7116_1099 OC=Bacteria; Cyanobacteria; Nostocales; Rivulariaceae; Rivularia.
Sequence
MENDAATLYCPNELCQAANPLTHKFCQRCSTPLPKRYLWAVADNSIVGNSGELLQERYLI
IEHNVLLDTKPGILPQMPEQQKLDDIKSYLRLIPYRLHVPQVYGMLSVNTGNTSEEILIL
EKPPLVLNELPTKVQLCGELTDAWKGANSLRQLNWLWQIAQLWQPLASVGVASSLLAKKL
LRAEGSIVRLLELSSDRESKPSLLALGKFWQQELLPKAQSTIRNFMGEVCRLLVEEQIHS
SEQLIAVLDNGLTSLGKCSKIDIRVFALTDTGPSRQRNEDSCYPQSGTTVSKPPSKSALT
IVCDGIGGHEGGDIASKTAIETIEQSLTQLASLPKDRIHPAVLLADLERAAAIANDKISQ
LNDSENRQGRQRMGTTVVMALPLGHEMYISHVGDSRAYLITQNNCHQVTLDDDVASREVR
LGYAVYRDAVAQAASGSLVQALGMNASSALHPTAQRFILDEDCVFLLCSDGLSDFDRVEQ
YWEAEILPLLKNSSDVVSVTKQLLEIANNQNGHDNVTIASMHCQTKYSEPKSALETTLAD
ISSISVTDSSHLAPVRQNLPNQKTQVITKKANIKGFNLPLILGIIALLTIAGGSLGYFWR
QGIIRSKSEPREVAQTENIPPKIAEPTFETNSQRIAQIDKGWLISAKAKLNLSKSTLPPA
DNNSSARRQPLPIFAPPASLLQVVQKQQISSSQDYWLQIKVCSVGDVEAAINSATATTGS
RTLLKPGEQVWLNSSQLTPSNVSISNPANKTSQCTQAETLAPKIEDSSTSVPVEDSLIPS
QPSIPSKPDSLSGSTTLPQTGNSTDSKTR
Download sequence
Identical sequences K9R991
gi|427734675|ref|YP_007054219.1| WP_015117250.1.44015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]