SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9RBD4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9RBD4
Domain Number 1 Region: 4-69
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 1.94e-16
Family 7-Fe ferredoxin 0.000061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K9RBD4
Sequence length 81
Comment (tr|K9RBD4|K9RBD4_9CYAN) PsaC {ECO:0000256|HAMAP-Rule:MF_01303} KW=Complete proteome; Reference proteome OX=373994 OS=Rivularia sp. PCC 7116. GN=Riv7116_2235 OC=Bacteria; Cyanobacteria; Nostocales; Rivulariaceae; Rivularia.
Sequence
MSHTVKIYDTCIGCTQCVRACPTDVLEMVPWDGCKAQQLAASPRTEDCVGCKRCETACPT
DFLSIRVYLGAETTRSMGLAY
Download sequence
Identical sequences K9RBD4
WP_015118331.1.44015 gi|427735759|ref|YP_007055303.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]