SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9RC51 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9RC51
Domain Number 1 Region: 47-155,196-364
Classification Level Classification E-value
Superfamily Pectin lyase-like 2.79e-36
Family Filamentous hemagglutinin FhaB, secretion domain 0.0073
Further Details:      
 
Domain Number 2 Region: 783-912
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000628
Family Filamentous hemagglutinin FhaB, secretion domain 0.06
Further Details:      
 
Domain Number 3 Region: 483-644
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000132
Family Filamentous hemagglutinin FhaB, secretion domain 0.035
Further Details:      
 
Domain Number 4 Region: 913-1031
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000245
Family Filamentous hemagglutinin FhaB, secretion domain 0.054
Further Details:      
 
Domain Number 5 Region: 653-782
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000565
Family Filamentous hemagglutinin FhaB, secretion domain 0.057
Further Details:      
 
Domain Number 6 Region: 338-481
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000753
Family Filamentous hemagglutinin FhaB, secretion domain 0.088
Further Details:      
 
Domain Number 7 Region: 1043-1166
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000033
Family Filamentous hemagglutinin FhaB, secretion domain 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K9RC51
Sequence length 1438
Comment (tr|K9RC51|K9RC51_9CYAN) Filamentous hemagglutinin family N-terminal domain protein {ECO:0000313|EMBL:AFY55535.1} KW=Complete proteome; Reference proteome OX=373994 OS=Rivularia sp. PCC 7116. GN=Riv7116_3057 OC=Bacteria; Cyanobacteria; Nostocales; Rivulariaceae; Rivularia.
Sequence
MKGIYWLGLGIAAFQAFLISPCFAQSSNIVPDNSLDAESSQVTENFQGLPVERITGGAER
GINLFHSFREFNVSEERGAYFFSPNAEIQNILTRVTGRNPSEILGTLGTFGSSQPNLFLI
NPNGIVFGENASLDVGGSFVASTANGINLGETGLFSATEPTTSNLLSVNPSALFFNAVNN
QAEIVNRSRATSTVLGSAENGDANRPINGLQVLDGKSLLLVGGNVSLDGGRLFAPGGRVE
LGGLTGAGEVGLGVDENLQLNYPVNLAKANVLLENDGAINVDGDRAGDVRIEGNNVNLNR
VSSIVSFTGNQDGGEILIRADKLELTENSRIATNTVGTGKSGDITIETGSFTTQENSLIF
STSFLAPGKTGNIHLKAKNSVNIFNSGGIFTLALGRGDGITTGSGGNISIETKDLTLQNG
NIAVSTFLGQGNAGDLTIKATNSVNSIGSLITTSSLGAGVGGSIFIETKKLNVENGANIL
SSVVDPSNFDFSTVNPRFSSPEAIAFINDLIATINPENVGKANSGNLTITASDSVKVSGE
SANGNASVLSTETSGAGNAGTLEIDTNKLFLTDGGNVSVSTALNSQGKGGDLVVNAGDSV
EISGTLANEQFRSGLFASTLGTGDAGEIQITTNKLLLNGGGVISGITNNSGKGGNLIVTA
TESVEVEGSSKNNFLPSALTTDTFSVGDAGNLKIDTGSLVIKDGGNVSVSTALNSQGKGG
NLIVNAGDSVEIIGTIANEQFSSGLFAATQGTGDAGEVEVITNKLKIRNGGIISATTTNQ
GNGGNLIVRATESVEIEGSSKNNFLSSGLTTDTFGIRNAGNLKIDTGRLVIKDGGAVSVS
TRPNSQGKGGNLIVNAGDSVEISGTTANEQFSSGLFAATQGIGDAGEVEVITNKLKIRNG
GIISATTTNQGNGGNLIVRATESAEIEGSSKNNLLFSALRTETFGAGDAGNLKFDVGSLS
LRDDAQLAASTFGTGDAGNVTVAAKDSVFLTGKAGILSTVESGSTGKGGNIDINATSLSL
EEGGQLLAFTRGASNGKPPGRGNAGSVNIDVVDAVTITGRKDIFNSGILTGMDTGTKGDG
GNINIKSGSFDLTGGAAIVTSTDSKGNAGNVKINARESVLIRDPDNAIFTTVEENGEGKG
GNIEINTASFSVLNASGVTAETKGQGTAGNITINATDSVTISGTVPGFIAGLYTAAIEPF
GKNLGDTGDIKVNSPKIVLDNDGTINAESASGNGGNINLTSDLLLMRRSAQISTNAGTAQ
QGGDGGNIDINSKFIVALPQENSDITANAFSGTGGNVDILSQGIFGIEPRQKESDLTSDI
TASSDLGVPGVLNLTDPDDSNIRNNLDDLPDNQIDTDALIANSCISRGTKRQENSFTITG
SGGLRKSPGDELVSQYSTGEVRSVEPTSRTWKKGDRIVEPTGVYKLSDGKVLLSRDCG
Download sequence
Identical sequences K9RC51
gi|427736538|ref|YP_007056082.1| WP_015119103.1.44015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]