SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9RDH1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9RDH1
Domain Number 1 Region: 47-155,209-379
Classification Level Classification E-value
Superfamily Pectin lyase-like 5.96e-37
Family Filamentous hemagglutinin FhaB, secretion domain 0.0089
Further Details:      
 
Domain Number 2 Region: 408-559
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000000408
Family P22 tailspike protein 0.076
Further Details:      
 
Domain Number 3 Region: 573-689
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000273
Family P22 tailspike protein 0.058
Further Details:      
 
Domain Number 4 Region: 667-765
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000534
Family P22 tailspike protein 0.074
Further Details:      
 
Weak hits

Sequence:  K9RDH1
Domain Number - Region: 770-815,846-871
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00879
Family P22 tailspike protein 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K9RDH1
Sequence length 1081
Comment (tr|K9RDH1|K9RDH1_9CYAN) Filamentous hemagglutinin family N-terminal domain protein {ECO:0000313|EMBL:AFY55533.1} KW=Complete proteome; Reference proteome OX=373994 OS=Rivularia sp. PCC 7116. GN=Riv7116_3055 OC=Bacteria; Cyanobacteria; Nostocales; Rivulariaceae; Rivularia.
Sequence
MKGIYWLGLSIAAFQAFLISPCFAQSSNIVPDNSLDAESSQVTENFQGLPVERITGGAER
GINLFHSFREFNVSEERGAYFFSPNAEIQNILTRVTGRNPSEILGTLGTFGNSQPNLFLI
NPNGIVFGENASLDVGGSFVASTANGINLGETGLFSATEPTTSNLLSVNPSALFFNAVNN
QAEIVNRSRATSTVLGIAENGDANRPINGLQVLDGKSLLLVGGGVSLDGGRLLALGGRVE
LGGLAAPGNVNLLSEGDNLKLGFPENVARADVSLTNQAFMRVEANGGGDIAINARNLDIL
QGSKLSAGIGQGLGTPETVAGDITLNAAGEIKVAGAGSNVRNAVRSGSQGKGGNIIIDSD
SFLLEDSAQLIASTLGIGNPGNVKVTAADAVSLVDAVILSTVEADGEAQAGNIDINAATL
SLTEGAQMLTLTRGASDSQPAGRGDAGNVNVKVTGLVDIAGEKNGFFSGISSSVEIGSQG
NGGNITIDSGSFSLRDGAQLIASTFGQGDAGNVIVSAKDTISVAGATIFSAVEAGSVGQG
GNIDINAATLSLTEGAQLLAINRNAFDTQSVGSGNAGNVNVKVTGLVDIAGEKNGFLSGI
FSSVEAGSRGNGGNITIDSGSFSLRDGAQLVASTFGQGDAGNFKVTATDAVSVAGNAGIF
STVEAGSVGKGGDIDINATTLSLTEGAQLLTITREASDTQSAGQGNAGNVNVKVTGSVNI
AGVKNGFPSGISSLVNTGTKGNGGNITIDSSSFSLRDGALIDAGTRNDDKGGDIRVNTDI
FEALKGGQLITTTSSNGSAGKITINAIQKAIVNGSYPNFNNLVAQQGDSVRNIGANSGLF
VSSSGSGDTGDIEVNSPQITLDNQGKLNANSASGNGGNINLTSDLLLMRRSAQISTNAGT
AQQGGDGGNIDINSKFIVALPQENSDITANAFSGTGGNVDILSQGIFGIEPRQKESDLTS
DITASSDLGVPGVLNLTDPDDSNIRNNLDDLPDNQIDTDALIANSCISRSTKRQENSFTI
TGSGGLRKSPGDELVSQYSTGKVRSVESTSRTWKKGDRIVEPTGVYKLSDGKVLLSRGCN
S
Download sequence
Identical sequences K9RDH1
gi|427736536|ref|YP_007056080.1| WP_015119101.1.44015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]