SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9RDW1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  K9RDW1
Domain Number - Region: 182-224
Classification Level Classification E-value
Superfamily TolA/TonB C-terminal domain 0.0141
Family TolA 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K9RDW1
Sequence length 276
Comment (tr|K9RDW1|K9RDW1_9CYAN) Uncharacterized protein {ECO:0000313|EMBL:AFY55519.1} KW=Complete proteome; Reference proteome OX=373994 OS=Rivularia sp. PCC 7116. GN=Riv7116_3040 OC=Bacteria; Cyanobacteria; Nostocales; Rivulariaceae; Rivularia.
Sequence
MVIKILLIIAALFAFSSIAFYIKFLSERQEVNTIWHLLETKTSNNTFTTEMIAELPQPVQ
RYFLHAIEQGTPLANSVKLNMNGSFRLSADKPWLPMQAEQIIRAFKGFVWKAKIGSGLMK
FIGSDYCFYNFARMRFSIWGIIPVINAHNQDITRSAIGRLAGESFWLPSALLPQNGVVWQ
AIDNNTIEASMKVDGESVNLTFTIDSDGKLLKVSVLRWGDKTEDGSHTYITFGGEVLEEK
TFAGFTIPSQITAGWWFGTDKYFNFFRANIEKAEFC
Download sequence
Identical sequences K9RDW1
WP_015119087.1.44015 gi|427736522|ref|YP_007056066.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]