SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9RED4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9RED4
Domain Number 1 Region: 5-291,435-496
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.92e-49
Family FAD-linked reductases, N-terminal domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K9RED4
Sequence length 496
Comment (tr|K9RED4|K9RED4_9CYAN) Choline dehydrogenase-like flavoprotein {ECO:0000313|EMBL:AFY55704.1} KW=Complete proteome; Reference proteome OX=373994 OS=Rivularia sp. PCC 7116. GN=Riv7116_3234 OC=Bacteria; Cyanobacteria; Nostocales; Rivulariaceae; Rivularia.
Sequence
MIIDDQNYDVIIIGTGAGGGTLAHKLALTGKKILVLEQGDFLEKESSELVEVEVFKKEDF
HAPQQWYDSESEPFHPQTSYSVGGNTKIYSGVLQRMREKDFEKIQHQDGVSPEWEVKYKD
FEPYYTEAEKLYQVHGKTGDDLTEPSRSEDFPFPVVDSEPQVEDICNRIAKKGLHPAYLP
IGVGNQGRTDSEDTGISPTIKSYDNVTLKTKARVVGLHTNPSGTEVKAVEAKIGDRSYLF
MGNIIVLSCGAINSAALLLSSANEKHPKGLANSSEFVGCNLMKQLMTTLVQITNTPNSGL
FQRTRYINDFYWGDENFSYPMGHIQNSGGILQDVIFAESPPLLSVAAKLMPGFGLKQLAK
RSIGWWLQTEDLPVPKNRVRFQGSKLYVDYTANNAEAHDRLVYRWIDVLKSIDGNKQNIY
PRGETPIQVVAHQSGTCRFGENAKTSVLDLNCRTHDIDNLYVVDSSFFPSMSATSPALTV
IANALRVGEHLIERLK
Download sequence
Identical sequences K9RED4
WP_015119272.1.44015 gi|427736707|ref|YP_007056251.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]