SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9RJ92 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  K9RJ92
Domain Number - Region: 2-125
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 0.00105
Family Gtf glycosyltransferase 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K9RJ92
Sequence length 160
Comment (tr|K9RJ92|K9RJ92_9CYAN) Uncharacterized protein {ECO:0000313|EMBL:AFY57167.1} KW=Complete proteome; Reference proteome OX=373994 OS=Rivularia sp. PCC 7116. GN=Riv7116_4754 OC=Bacteria; Cyanobacteria; Nostocales; Rivulariaceae; Rivularia.
Sequence
MITVTLGTIPFAFNRAIDWLERLLSAGVISESVFVQHGTTDVSILAKYSFVTTTPIVETS
FLMKTIGESRLIVSHAGQGLTRGLAAQGACFILVPRLSRYNEHIDDHQLWFARGVEKLGI
THCTSLDNFEQAVKCPPPSFKGQIFDEPRLAEHLMQIYPR
Download sequence
Identical sequences K9RJ92
WP_015120726.1.44015 gi|427738170|ref|YP_007057714.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]