SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9RQD7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9RQD7
Domain Number 1 Region: 148-310
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 9.32e-48
Family Pentapeptide repeats 0.00007
Further Details:      
 
Domain Number 2 Region: 292-442
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 1.31e-39
Family Pentapeptide repeats 0.00021
Further Details:      
 
Domain Number 3 Region: 15-151
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 1.1e-36
Family Pentapeptide repeats 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K9RQD7
Sequence length 449
Comment (tr|K9RQD7|K9RQD7_SYNP3) Putative low-complexity protein {ECO:0000313|EMBL:AFY59479.1} KW=Complete proteome; Reference proteome OX=195253 OS=Synechococcus sp. (strain ATCC 27167 / PCC 6312). GN=Syn6312_0238 OC=Synechococcus.
Sequence
MNPQELLKRYASGQRDFNRASLSNAELINVDLSGINLARADLEWVNLSGTKLNNANLSGA
ELINAILIKTDLSQANLTGVNLSRTDLSWANLSYTNLSRSELSEATLRGANLQGADLSRV
DLAEADLRGLGFNQVNLRGANLQGANLHNTEMVQADLGRVDLIEADLSNANLSGANLSGA
NLSRANLANANLSGADLSRVDLTEVKLSEANLTKANLSGAELGKADLSALELCDVNLSGA
NLSGANLANTNLSRADLSGANLRGVNLSRAKLVGTNLRGANLVGANLTGATLDGADLSQA
DMRSANLSGLLLNGVILRGANLSGANLREIELNQANLSRADLIEANLSRAKMAGVNLSRA
TLSEANMSRATLSGATLSRVTLSGDTIGKVDLSGVNLSGADLGDAQLLGANLSRADLTRV
NLTAADLSSSNLSEVDLRGTIMPDGRRRN
Download sequence
Identical sequences K9RQD7
WP_015123023.1.5248 gi|427711398|ref|YP_007060022.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]