SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9RSF4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9RSF4
Domain Number 1 Region: 57-199
Classification Level Classification E-value
Superfamily Elongation factor Ts (EF-Ts), dimerisation domain 9.16e-46
Family Elongation factor Ts (EF-Ts), dimerisation domain 0.0000152
Further Details:      
 
Domain Number 2 Region: 3-56
Classification Level Classification E-value
Superfamily UBA-like 8.82e-20
Family TS-N domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K9RSF4
Sequence length 254
Comment (tr|K9RSF4|K9RSF4_SYNP3) Elongation factor Ts {ECO:0000256|HAMAP-Rule:MF_00050, ECO:0000256|RuleBase:RU000642} KW=Complete proteome; Reference proteome OX=195253 OS=Synechococcus sp. (strain ATCC 27167 / PCC 6312). GN=Syn6312_0812 OC=Synechococcus.
Sequence
MAEISAKLVKELRDKTGAGMMDCKKALTESDADMEKAIEWLRQKGLASAGKKSGRVTAEG
LVDSYIHTGGRIGVLVEVNCETDFVARNEAFKELVQNIAKQIAACPNVEYVAIEDIPAAV
VENERKIAMGSDALAGKKEEVKAKIVQGKLDKTLREMCLLDQAYIRDQNISVAELVTQSI
AQLGENIKIRRFQRFILGEGIEKVESNLAAEVAAQTQAKPEPAPAPTPEPEPTPEPAPKA
TKAKTTRSSRSKAK
Download sequence
Identical sequences K9RSF4
gi|427711946|ref|YP_007060570.1| WP_015123571.1.5248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]