SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9RV70 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9RV70
Domain Number 1 Region: 3-125
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1e-26
Family HD domain 0.00093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K9RV70
Sequence length 146
Comment (tr|K9RV70|K9RV70_SYNP3) Uncharacterized protein {ECO:0000313|EMBL:AFY61204.1} KW=Complete proteome; Reference proteome OX=195253 OS=Synechococcus sp. (strain ATCC 27167 / PCC 6312). GN=Syn6312_2079 OC=Synechococcus.
Sequence
MPTISKAIEIATQAHQGQVDKAGKPYISHPLAVMALVDGELEKIVAVLHDVVEDTPISLN
DLAAEGFSAECLAAVDAITKRDGEPLDDYLERVKSNPIAIKVKLADLTHNMDLSRIAEPT
AKDFARIERYKQTYQTLQAISGEFHN
Download sequence
Identical sequences K9RV70
gi|427713123|ref|YP_007061747.1| WP_015124747.1.5248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]