SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9RX14 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  K9RX14
Domain Number - Region: 73-96
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.00918
Family PhnA zinc-binding domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K9RX14
Sequence length 125
Comment (tr|K9RX14|K9RX14_SYNP3) Hydrogenase maturation factor HypA {ECO:0000256|HAMAP-Rule:MF_00213} KW=Complete proteome; Reference proteome OX=195253 OS=Synechococcus sp. (strain ATCC 27167 / PCC 6312). GN=Syn6312_2926 OC=Synechococcus.
Sequence
MHETDMTKALILTVKDWWEAQPEKPQITKVHLTVGKFTCVEPMSLQFAFKVQTENTFLAG
AELVITEIPLIAFCHRCQEEYFPEMGQRYTCPNCGQPMEDIRSGRELKIERVEFSDSSPT
KQSLP
Download sequence
Identical sequences K9RX14
gi|427713907|ref|YP_007062531.1| WP_015125530.1.5248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]