SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9RZZ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9RZZ0
Domain Number 1 Region: 2-77
Classification Level Classification E-value
Superfamily L28p-like 2.94e-26
Family Ribosomal protein L28 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K9RZZ0
Sequence length 78
Comment (tr|K9RZZ0|K9RZZ0_SYNP3) 50S ribosomal protein L28 {ECO:0000256|HAMAP-Rule:MF_00373} KW=Complete proteome; Reference proteome OX=195253 OS=Synechococcus sp. (strain ATCC 27167 / PCC 6312). GN=Syn6312_3614 OC=Synechococcus.
Sequence
MSRVCQLTGKKANNAYAVSHSHRRTKKLQEVNLQWKRIWWPEGNRWVRLRLSTKAIKTLQ
FKGLSAFAKEAGLNLHKL
Download sequence
Identical sequences K9RZZ0
WP_015126169.1.5248 gi|427714551|ref|YP_007063175.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]