SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9S2W8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9S2W8
Domain Number 1 Region: 375-581
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.7e-33
Family TK-like Pyr module 0.03
Further Details:      
 
Domain Number 2 Region: 58-338
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.15e-32
Family TK-like PP module 0.0044
Further Details:      
 
Domain Number 3 Region: 586-737
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.0000000000000436
Family Transketolase C-terminal domain-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K9S2W8
Sequence length 738
Comment (tr|K9S2W8|K9S2W8_9CYAN) Transketolase central region {ECO:0000313|EMBL:AFY64543.1} KW=Complete proteome; Reference proteome OX=1173025 OS=Geitlerinema sp. PCC 7407. GN=GEI7407_0037 OC=Coleofasciculaceae; Geitlerinema.
Sequence
MTTTPAQGAARSAPAFCEGILHFGESLPGFEAHGQAPAIAQGQTAIAQPSDPAAVFQTLL
AADALRYLTLQVTASKASGHPGGFASVAEAIAALVMLGYKNIITEVGHHAPGFYSTMFLD
RSLEAMGISTVQQMGERFREMHGLLGHLSGQIPGLLNPAGPLGQGQHFAMAGALLHPGTL
FPVTIGDGGLGEPYIMSSMAHFHTAYPHATNFLPILVWNGYSQEHHSMVSTKPNEEMIAY
WKGNGFQNVILVNAKDFDDADQPGDYVDSTAFSIQQRLAFTQAVLEATQKAAQAALSGEL
TVLIIKQLKGAGVHARGAKSHNLYPQHTLDNPEIVSALQERSLSAEAWQLVRTNFERAAG
GPASTHVVTEKELPLPDLGTLPLTEFPVKGDKQVATTAMGELVVHVGQKDPNFVVTNADG
NAASGINNINVGLKIIHPTLDDTYFQAPKGQVYEPLSEDACAGLAVGLALFGARSLWCSY
ESFAINGLPIWQTVTQAMTELRRPTPSTITLFTAGALEQGRNGWTHQRPEIENYFAAMMR
NGNIFPLFPCDANSIQACYEWALGTKNKGITITASKSPLPVRTTLEQTRQGLKDGGIVLH
DSEGSRKVVFAVVGDMTLLPVLDAATHLEAEGIGVRVVSVINPRRLYRPTDVAWETCTEP
DSHFLEDAEFERFFGGDAVIGVTGGSSAMLEPLMLRSTAKRDIFAWKRGETTATAGDLMS
FNGLTAEALSQRATELLG
Download sequence
Identical sequences K9S2W8
WP_015170111.1.54702 gi|428223498|ref|YP_007107595.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]