SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9S2Y5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9S2Y5
Domain Number 1 Region: 24-259
Classification Level Classification E-value
Superfamily PLP-binding barrel 1.74e-71
Family Alanine racemase-like, N-terminal domain 0.0000119
Further Details:      
 
Domain Number 2 Region: 253-388
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 4.88e-48
Family Alanine racemase 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K9S2Y5
Sequence length 400
Comment (tr|K9S2Y5|K9S2Y5_9CYAN) Alanine racemase {ECO:0000256|HAMAP-Rule:MF_01201} KW=Complete proteome; Reference proteome OX=1173025 OS=Geitlerinema sp. PCC 7407. GN=GEI7407_0057 OC=Coleofasciculaceae; Geitlerinema.
Sequence
MLERLGSLGELQDQMQCDRAWVEINLEALTHNVRQLKQWLAPKTDLMAVVKADAYGHGAI
AVARTALAAGATWLGVATVSEGIQLRRAGIEAPILILGATHTPDQIRAIAYWRLDPTLCT
PQQAQTFSETLASLDRHLPVHLKIDTGMSRLGMPWQEAVKFVQAVQDLPHLRIASVYSHL
ATADDPDPTILYQQHQRFEVAIAQVRAANLPLPRLHLANSAATLADRSLHYDMVRVGLAT
YGLYPAPHLRSVLPLRPVMQVKARITQVKHIQPGTGVSYGHRFVADRPMDIATVGIGYAD
GVPRNLSNRMTALLRGQPVAQLGSVTMDQLMLDMTSIDQPQVGEIVTLLGRDGAQAITAD
DWAELLGTISWEILCGFKHRLPRVAVGQPQTSREASILRI
Download sequence
Identical sequences K9S2Y5
gi|428223518|ref|YP_007107615.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]