SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9S5E6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9S5E6
Domain Number 1 Region: 50-112,178-342
Classification Level Classification E-value
Superfamily Isochorismatase-like hydrolases 0.00000903
Family Isochorismatase-like hydrolases 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K9S5E6
Sequence length 348
Comment (tr|K9S5E6|K9S5E6_9CYAN) Uncharacterized protein {ECO:0000313|EMBL:AFY64989.1} KW=Complete proteome; Reference proteome OX=1173025 OS=Geitlerinema sp. PCC 7407. GN=GEI7407_0489 OC=Coleofasciculaceae; Geitlerinema.
Sequence
MTQSVSHSLPLPPHFEAGRVGQVWRVPYQARAEQARAWAKQHAIAPAAKDKTRLCLMAID
VQNTFCIPDFELFVGGRSGQGAVQDNVRLCEFIYRNLGLITEIAPTMDTHTVMQIFHSQF
WVNDAGDNPPPMTTISLAQVQQGHWKVNPAIAHSLAKGNYLLLQSYALHYVQTLSQDGKY
PLTIWPYHSMLGGIGHALVSAVEEACFFHNIARHSQTNFEIKGGNPLTENYSVLRPEVLD
GPDGRPIAQKNTRFIQKLLEFDAVIIAGQAKSHCVAWTIADLLSEIQAQDPALAKKVYLL
EDCTSAVVVPGVVDFTDQADAAFQRFADAGMHLVRSTEAIAHWPDLSL
Download sequence
Identical sequences K9S5E6
WP_015170557.1.54702 gi|428223944|ref|YP_007108041.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]