SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9SA48 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9SA48
Domain Number 1 Region: 6-203
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.28e-68
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.00000599
Further Details:      
 
Domain Number 2 Region: 187-323
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 2.62e-41
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K9SA48
Sequence length 327
Comment (tr|K9SA48|K9SA48_9CYAN) Transketolase central region {ECO:0000313|EMBL:AFY67030.1} KW=Complete proteome; Reference proteome OX=1173025 OS=Geitlerinema sp. PCC 7407. GN=GEI7407_2555 OC=Coleofasciculaceae; Geitlerinema.
Sequence
MAETFMFNALREAVDEEMARDPSVFVLGEDVGHYGGSYKVTKDLYKKYGDLRVLDTPIAE
NSFTGMAVGAAMTGLRPIIEGMNMGFLLLAFNQIANNAGMLRYTSGGNYKIPMVIRGPGG
VGRQLGAEHSQRLEAYFQAVPGLKIVACSTAYNAKGLLKAAIRDDNPVLFFEHVLLYNLK
ENLPDEEYVLPLDKAEIVRRGKDVTILTYSRMRHHVTQALKTLEKEGFDPEVIDLISLKP
LDFDTIGESIRKTHRVIVVEECMRTGGIGAEIVASINDRFFDELDAPVLRMSSQDIPTPY
NGALERLTIVQPEDIVEAVRKMVALRV
Download sequence
Identical sequences K9SA48
WP_015172594.1.54702 gi|428225985|ref|YP_007110082.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]