SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9SE92 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9SE92
Domain Number 1 Region: 5-368
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.95e-27
Family FAD/NAD-linked reductases, N-terminal and central domains 0.01
Further Details:      
 
Domain Number 2 Region: 336-453
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 3.78e-19
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K9SE92
Sequence length 475
Comment (tr|K9SE92|K9SE92_9CYAN) Pyridine nucleotide-disulfide oxidoreductase dimerization region {ECO:0000313|EMBL:AFY68266.1} KW=Complete proteome; Reference proteome OX=1173025 OS=Geitlerinema sp. PCC 7407. GN=GEI7407_3799 OC=Coleofasciculaceae; Geitlerinema.
Sequence
MAVDYDLVIVGSTPTAIAAARAALRSQGRVALVSQRSPEEGLGPETPLLPSLSALGAIAQ
QQPLAHWLGLADSARAELQWPAALAWHHALGDTLAPDPAVLAAQGLEVILGQGAFRREPS
LGFNLADRCLRSRAYLIATGSHTGRPAIEGLDAVPYWTPETLATQPPEVLPERLLILGGQ
GLAVAWAEAFARFGVAVTLITRQPRLLPQAEPEAVALIQAQLEADGVRILTGSPITQARM
LDQEVWVQAGNDALAGDRLLVVAAPQPNLTGLNLEAVRVRATPRGLSVKPWLQTAHPRIY
ACGAVLGGDPAPYIGHHEAAIAVENALWGRRRVPHYQAIPQWVPTQNPLISLGLTEAQAS
QQYHEDAWVLRCPYKALPQAHLHHQVNGFAKLIVRPSGQILGAHILGPAAPELMSAIALL
QESSQGMPALERLIPIAPSYSEVWTQLGQQWRDRRHQRWGPWLEALAAWRRARAR
Download sequence
Identical sequences K9SE92
WP_015173830.1.54702 gi|428227221|ref|YP_007111318.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]