SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K9SE94 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K9SE94
Domain Number 1 Region: 86-394
Classification Level Classification E-value
Superfamily Pectin lyase-like 3.14e-36
Family Pectate transeliminase 0.019
Further Details:      
 
Weak hits

Sequence:  K9SE94
Domain Number - Region: 477-509
Classification Level Classification E-value
Superfamily Sporulation related repeat 0.034
Family Sporulation related repeat 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K9SE94
Sequence length 514
Comment (tr|K9SE94|K9SE94_9CYAN) Parallel beta-helix repeat protein {ECO:0000313|EMBL:AFY68518.1} KW=Complete proteome; Reference proteome OX=82654 OS=Pseudanabaena sp. PCC 7367. GN=Pse7367_0201 OC=Pseudanabaena.
Sequence
MPKLQTIGLAISMALLSPQIALAHTYNLNSANSNLNSANSKLNSANSKLNSANSNLNLAN
SNSSNDVASQNLANRSLIAQNYIGQVTIFVDPNGNDTYGNGSQSQPFRTITAALATNPQP
GTVIRLAPGTYSTNTGENFPLKLSPGVQLRGNGNTKGRDIIIQGGGRFVSPTFGGQNITI
LAANNSHIGGITISNPNTRGYGLWVEGRNNVTIANNTFTNTSHDGVFLTGKANVLVSENI
FTRNRGSGISAVGDSNGEIRGNTFDNTGFGLSIGQRSRVVLRDNQIVNNMDGVIISNVAT
PALRGNTIANNRRNGLVVLKDRNRQPSPDLGTASNPGRNVFRSNGEKDINNVSGVSVIAA
GNQFDRNKIAGALDTVANVPSDLDRRSPTTIASLPSPRPTNNALPLPTNPSNPNNNYNYD
FPTEILIEREPSNPGNRPIALSPTAPATLRYRVVVPMGGNSNLASVRKVVPDAFRSNKNG
RTVIQAGAFAQRQVAEQRLQLLSQAGFRPTLENL
Download sequence
Identical sequences K9SE94
gi|428216481|ref|YP_007100946.1| WP_015163492.1.5078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]